SCN1B

SCN1B
Identifikatori
AliasiSCN1B
Vanjski ID-jeviOMIM: 600235 MGI: 98247 HomoloGene: 810 GeneCards: SCN1B
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za SCN1B
Genomska lokacija za SCN1B
Bend19q13.11Početak35,030,470 bp[1]
Kraj35,040,449 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za SCN1B
Genomska lokacija za SCN1B
Bend7 B1|7 19.3 cMPočetak30,815,949 bp[2]
Kraj30,826,428 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija sodium channel activity
voltage-gated ion channel activity
voltage-gated sodium channel activity involved in Purkinje myocyte action potential
voltage-gated sodium channel activity involved in cardiac muscle cell action potential
voltage-gated sodium channel activity
sodium channel regulator activity
sodium channel inhibitor activity
GO:0001948, GO:0016582 vezivanje za proteine
transmembrane transporter binding
Ćelijska komponenta integral component of membrane
membrana
sodium channel complex
extracellular region
voltage-gated sodium channel complex
Ranvijerov čvor
Interkalirani disk
T-tubule
ćelijska membrana
Biološki proces membrane depolarization during Purkinje myocyte cell action potential
cardiac muscle contraction
regulation of sodium ion transport
sodium ion transport
regulation of atrial cardiac muscle cell membrane depolarization
membrane depolarization
regulation of ion transmembrane transport
cardiac muscle cell action potential involved in contraction
ion transport
Ćelijska adhezija
regulation of sodium ion transmembrane transporter activity
GO:0061423 positive regulation of sodium ion transport
response to pyrethroid
regulation of heart rate by cardiac conduction
chemical synaptic transmission
corticospinal neuron axon guidance
neuronal action potential propagation
axon guidance
cardiac conduction
regulation of ventricular cardiac muscle cell membrane repolarization
sodium ion transmembrane transport
locomotion
positive regulation of neuron projection development
membrane depolarization during cardiac muscle cell action potential
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001037
NM_199037
NM_001321605

NM_011322

RefSeq (bjelančevina)

NP_001028
NP_001308534
NP_950238

NP_035452
NP_001389263

Lokacija (UCSC)Chr 19: 35.03 – 35.04 MbChr 7: 30.82 – 30.83 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica beta-1 natrijevog kanala jest protein koji je kod ljudi kodiran genom SCN1B sa hromosoma 19.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 218 aminokiselina, a molekulska težina 24.707 Da.[6]

1020304050
MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETN
AETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKD
LQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKA
NRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEY
LAITSESKENCTGVQVAE

Funkcija

Naponski vođeni natrijski kanali su neophodni za stvaranje i širenje akcijskih potencijala u prugasto-prugastim mišićima i neuronskim tkivima. Biohemijski, sastoje se od velike alfa podjedinice i 1 ili 2 manje beta podjedinice, kao što je SCN1B. Sama podjedinica alfa može pokazati sve funkcionalne atribute naponski vođenog Na+ kanala, ali joj je potrebna beta-1 podjedinica za normalnu kinetiku inaktivacije (prema OMIM[6]

Klinički značaj

Mutacije u genu SCN1B povezane su s poremećajima kao što su Brugadaov sindrom, Dravetin sindrom i GEFS.

Također pogledajte

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000105711 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000019194 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ McClatchey AI, Cannon SC, Slaugenhaupt SA, Gusella JF (Sep 1993). "The cloning and expression of a sodium channel beta 1-subunit cDNA from human brain". Hum Mol Genet. 2 (6): 745–9. doi:10.1093/hmg/2.6.745. PMID 8394762.
  6. ^ a b c "Entrez Gene: SCN1B sodium channel, voltage-gated, type I, beta".

Dopunska literatura

Vanjski linkovi

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.


Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.