TRPC6

TRPC6
Identifikatori
AliasiTRPC6
Vanjski ID-jeviOMIM: 603652 MGI: 109523 HomoloGene: 37944 GeneCards: TRPC6
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za TRPC6
Genomska lokacija za TRPC6
Bend11q22.1Početak101,451,564 bp[1]
Kraj101,872,562 bp[1]
Lokacija gena (miš)
Hromosom 9 (miš)
Hrom.Hromosom 9 (miš)[2]
Hromosom 9 (miš)
Genomska lokacija za TRPC6
Genomska lokacija za TRPC6
Bend9 A1|9 2.46 cMPočetak8,544,143 bp[2]
Kraj8,680,742 bp[2]
Ontologija gena
Molekularna funkcija actinin binding
store-operated calcium channel activity
clathrin binding
inositol 1,4,5 trisphosphate binding
ion channel activity
GO:0001948, GO:0016582 vezivanje za proteine
actin binding
calcium channel activity
cation channel activity
protein homodimerization activity
ATPase binding
Ćelijska komponenta citoplazma
integral component of membrane
membrana
ćelijska membrana
integral component of plasma membrane
slit diaphragm
cation channel complex
Biološki proces regulation of cytosolic calcium ion concentration
positive regulation of cytosolic calcium ion concentration
GO:0010260 starenje
cation transport
ion transport
single fertilization
platelet activation
positive regulation of ion transmembrane transporter activity
negative regulation of dendrite morphogenesis
positive regulation of peptidyl-threonine phosphorylation
calcium ion transmembrane transport
positive regulation of neuron differentiation
neuron differentiation
manganese ion transport
cellular response to hypoxia
calcium ion transport
cellular response to hydrogen peroxide
positive regulation of calcium ion transport
transmembrane transport
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004621

NM_001282086
NM_001282087
NM_013838

RefSeq (bjelančevina)

NP_004612

NP_001269015
NP_001269016
NP_038866

Lokacija (UCSC)Chr 11: 101.45 – 101.87 MbChr 9: 8.54 – 8.68 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Član 6 potporodice C potencijalni kationski kanal prolaznog receptora, također poznat kao TRPC6, je ljudski gen koji kodira istoimeni protein. TRPC6 je prolazni receptor potencijalnog kanala klasične potporodice TRPC, sa hromosoma 11.. Povezana je sa depresijom i ankilozom (vidi ispod), kao i sa fokusnom segmentnom glomerulosklerozom.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 931 aminokiselina, a molekulska težina 106.326 Da.

1020304050
MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC
YGYYPCFRGSDNRLAHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEE
RFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLAVANEHLEITE
LLLKKENLSRVGDALLLAISKGYVRIVEAILSHPAFAEGKRLATSPSQSE
LQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHD
YFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALEL
SNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDV
ETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQ
QTMAVKFLVVLAVAIGLPFLALIYWFAPCSKMGKIMRGPFMKFVAHAASF
TIFLGLLVMNAADRFEGTKLLPNETSTDNAKQLFRMKTSCFSWMEMLIIS
WVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWH
ASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYA
IAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMI
GMFNLYSYYIGAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFI
ENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLW
FSYFEEGRTLPVPFNLVPSPKSLFYLLLKLKKWISELFQGHKKGFQEDAE
MNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSEDFHLNSFNN
PPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLE
EKSQNTEDLAELIRELGEKLSMEPNQEETNR

Interakcije

Pokazalo se da TRPC6 ima interakcije sa:

Dva od primarnih aktivnih sastojka odgovornih za antidepresive i anksiolitike koriste Hypericum perforatum, također poznat kao kantarion, su hiperforin i adhiperforin.[9][10] Ovi spojevi su inhibitori ponovnog preuzimanja serotonina, noradrenalina, dopamina, γ-izobutene kiseline i glutamata, a prijavljeno je da ispoljavaju ove efekt vezivanje za i aktiviranje TRPC6.[10][11] Nedavni rezultati sa hiperforinom doveli su u sumnju ove nalaze jer se slične struje vide nakon liječenja hiperforinom bez obzira na prisustvo TRPC6.[12]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000137672 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000031997 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Winn MP, Conlon PJ, Lynn KL, Farrington MK, Creazzo T, Hawkins AF, Daskalakis N, Kwan SY, Ebersviller S, Burchette JL, Pericak-Vance MA, Howell DN, Vance JM, Rosenberg PB (juni 2005). "A mutation in the TRPC6 cation channel causes familial focal segmental glomerulosclerosis". Science. 308 (5729): 1801–4. doi:10.1126/science.1106215. PMID 15879175. S2CID 23967918.
  6. ^ Hisatsune C, Kuroda Y, Nakamura K, Inoue T, Nakamura T, Michikawa T, Mizutani A, Mikoshiba K (april 2004). "Regulation of TRPC6 channel activity by tyrosine phosphorylation". The Journal of Biological Chemistry. 279 (18): 18887–94. doi:10.1074/jbc.M311274200. PMID 14761972.
  7. ^ Chu X, Tong Q, Cheung JY, Wozney J, Conrad K, Mazack V, Zhang W, Stahl R, Barber DL, Miller BA (mart 2004). "Interaction of TRPC2 and TRPC6 in erythropoietin modulation of calcium influx". The Journal of Biological Chemistry. 279 (11): 10514–22. doi:10.1074/jbc.M308478200. PMID 14699131.
  8. ^ Hofmann T, Schaefer M, Schultz G, Gudermann T (maj 2002). "Subunit composition of mammalian transient receptor potential channels in living cells". Proceedings of the National Academy of Sciences of the United States of America. 99 (11): 7461–6. doi:10.1073/pnas.102596199. PMC 124253. PMID 12032305.
  9. ^ Müller WE, Singer A, Wonnemann M (juli 2001). "Hyperforin--antidepressant activity by a novel mechanism of action". Pharmacopsychiatry. 34 Suppl 1: S98-102. doi:10.1055/s-2001-15512. PMID 11518085.
  10. ^ a b Chatterjee SS, Bhattacharya SK, Wonnemann M, Singer A, Müller WE (1998). "Hyperforin as a possible antidepressant component of hypericum extracts". Life Sciences. 63 (6): 499–510. doi:10.1016/S0024-3205(98)00299-9. PMID 9718074.
  11. ^ Leuner K, Kazanski V, Müller M, Essin K, Henke B, Gollasch M, Harteneck C, Müller WE (decembar 2007). "Hyperforin--a key constituent of St. John's wort specifically activates TRPC6 channels". FASEB Journal. 21 (14): 4101–11. doi:10.1096/fj.07-8110com. PMID 17666455. S2CID 14097884.
  12. ^ Sell TS, Belkacemi T, Flockerzi V, Beck A (decembar 2014). "Protonophore properties of hyperforin are essential for its pharmacological activity". Scientific Reports. 4: 7500. doi:10.1038/srep07500. PMC 4266863. PMID 25511254.

Dopunska literatura

Vanjski linkovi


Šablon:Modulatori potencijalnog prolaznog kanalskog receptora

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.