SCN4B

SCN4B
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4MZ2, 4MZ3

Identifikatori
AliasiSCN4B
Vanjski ID-jeviOMIM: 608256 MGI: 2687406 HomoloGene: 18384 GeneCards: SCN4B
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za SCN4B
Genomska lokacija za SCN4B
Bend11q23.3Početak118,133,377 bp[1]
Kraj118,152,888 bp[1]
Lokacija gena (miš)
Hromosom 9 (miš)
Hrom.Hromosom 9 (miš)[2]
Hromosom 9 (miš)
Genomska lokacija za SCN4B
Genomska lokacija za SCN4B
Bend9|9 A5.2Početak45,049,693 bp[2]
Kraj45,065,450 bp[2]
Ontologija gena
Molekularna funkcija sodium channel regulator activity
transmembrane transporter binding
sodium channel activity
voltage-gated ion channel activity
voltage-gated sodium channel activity involved in cardiac muscle cell action potential
voltage-gated sodium channel activity
Ćelijska komponenta voltage-gated sodium channel complex
integral component of membrane
membrana
Interkalirani disk
intrinsic component of plasma membrane
ćelijska membrana
Biološki proces cardiac muscle contraction
sodium ion transmembrane transport
sodium ion transport
regulation of ion transmembrane transport
cardiac muscle cell action potential involved in contraction
ion transport
regulation of sodium ion transmembrane transporter activity
GO:0061423 positive regulation of sodium ion transport
AV node cell action potential
regulation of heart rate by cardiac conduction
membrane depolarization during cardiac muscle cell action potential
regulation of ventricular cardiac muscle cell membrane repolarization
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001142348
NM_001142349
NM_174934

NM_001013390

RefSeq (bjelančevina)

NP_001135820
NP_001135821
NP_777594

NP_001013408

Lokacija (UCSC)Chr 11: 118.13 – 118.15 MbChr 9: 45.05 – 45.07 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

β-podjedinica 4 natrijevog kanala, znana i kao SCN4B ili Naβ4, i pomoćna je podjedinica natrijskih kanala koja može promijeniti njihovu kinetiku. To jest protein koji je kod ljudi kodiran genom SCN4B sa hromosoma 11.[5][6] Mutacije u SCN4B povezane su sa sindromom dugog QT intervala.[7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 228 aminokiselina, a molekulska masa 24.969 Da.[6]

1020304050
MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEIL
LPCTFSSCFGFEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDR
ITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ
VVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKE
CLVSSSGNDNTENGLPGSKAEEKPPSKV

Funkcija

SCN4B might additionally function as a cell adhesion molecule.[8][9]

Također pogledajte

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000177098 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000046480 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Lewis, Amanda H.; Raman, Indira M. (15. 11. 2014). "Resurgent current of voltage-gated Na+ channels". The Journal of Physiology (jezik: engleski). 592 (22): 4825–4838. doi:10.1113/jphysiol.2014.277582. ISSN 1469-7793. PMC 4259529. PMID 25172941.
  6. ^ a b "Entrez Gene: sodium channel".
  7. ^ Medeiros-Domingo A, Kaku T, Tester DJ, Iturralde-Torres P, Itty A, Ye B, Valdivia C, Ueda K, Canizales-Quinteros S, Tusié-Luna MT, Makielski JC, Ackerman MJ (juli 2007). "SCN4B-encoded sodium channel beta4 subunit in congenital long-QT syndrome". Circulation. 116 (2): 134–42. doi:10.1161/CIRCULATIONAHA.106.659086. PMC 3332546. PMID 17592081.
  8. ^ Shimizu, Hideaki (2016). "Structure-based site-directed photo-crosslinking analyses of multimeric cell-adhesive interactions of voltage-gated sodium channel β subunits". Scientific Reports. 6: 26618. Bibcode:2016NatSR...626618S. doi:10.1038/srep26618. PMC 4877568. PMID 27216889.
  9. ^ Shimizu, Hideaki (2017). "Parallel homodimer structures of the extracellular domains of the voltage-gated sodium channel β4 subunit explain its role in cell-cell adhesion". J Biol Chem. 27 (32): 13428–13440. doi:10.1074/jbc.M117.786509. PMC 5555201. PMID 28655765.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.