ETS2

ETS2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4BQA, 4MHV

Identifikatori
AliasiETS2
Vanjski ID-jeviOMIM: 164740 MGI: 95456 HomoloGene: 3838 GeneCards: ETS2
Lokacija gena (čovjek)
Hromosom 21 (čovjek)
Hrom.Hromosom 21 (čovjek)[1]
Hromosom 21 (čovjek)
Genomska lokacija za ETS2
Genomska lokacija za ETS2
Bend21q22.2Početak38,805,183 bp[1]
Kraj38,824,955 bp[1]
Lokacija gena (miš)
Hromosom 16 (miš)
Hrom.Hromosom 16 (miš)[2]
Hromosom 16 (miš)
Genomska lokacija za ETS2
Genomska lokacija za ETS2
Bend16 C4|16 56.64 cMPočetak95,502,942 bp[2]
Kraj95,522,095 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija vezivanje sa DNK
sequence-specific DNA binding
RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001948, GO:0016582 vezivanje za proteine
glucocorticoid receptor binding
protein domain specific binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta ćelijska membrana
nukleoplazma
jedro
citosol
Biološki proces skeletal system development
Ćelijska diferencijacija
GO:0009373 regulation of transcription, DNA-templated
GO:1901227 negative regulation of transcription by RNA polymerase II
transcription, DNA-templated
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
ectodermal cell fate commitment
mesoderm development
primitive streak formation
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001256295
NM_005239

NM_011809

RefSeq (bjelančevina)

NP_001243224
NP_005230

NP_035939

Lokacija (UCSC)Chr 21: 38.81 – 38.82 MbChr 16: 95.5 – 95.52 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein C-ETS2 jest protein koji je kod ljudi kodiran genom ETS2 sa hromosoma 21.[5][6] Protein kodiran ovim genom pripada ETS porodici transkripcijskih faktora.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 469 aminokiselina, a molekulska težina 53.001 Da.[5]

1020304050
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQ
EVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIP
KNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLEL
APDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGT
EQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVT
YCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIP
AAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA
RRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL
GFTPEELHAILGVQPDTED

Interakcije

Pokazalo se da ETS2 ima interakcije sa:

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000157557 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022895 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c Dwyer J, Li H, Xu D, Liu JP (Oct 2007). "Transcriptional regulation of telomerase activity: roles of the Ets transcription factor family". Annals of the New York Academy of Sciences. 1114 (1): 36–47. Bibcode:2007NYASA1114...36D. doi:10.1196/annals.1396.022. PMID 17986575. S2CID 44532648.
  6. ^ "Entrez Gene: ETS2 V-ets erythroblastosis virus E26 oncogene homolog 2 (avian)".
  7. ^ a b Basuyaux JP, Ferreira E, Stéhelin D, Butticè G (Oct 1997). "The Ets transcription factors interact with each other and with the c-Fos/c-Jun complex via distinct protein domains in a DNA-dependent and -independent manner". The Journal of Biological Chemistry. 272 (42): 26188–95. doi:10.1074/jbc.272.42.26188. PMID 9334186.
  8. ^ Kasten M, Giordano A (Apr 2001). "Cdk10, a Cdc2-related kinase, associates with the Ets2 transcription factor and modulates its transactivation activity". Oncogene. 20 (15): 1832–8. doi:10.1038/sj.onc.1204295. PMID 11313931.
  9. ^ Dudek H, Tantravahi RV, Rao VN, Reddy ES, Reddy EP (Feb 1992). "Myb and Ets proteins cooperate in transcriptional activation of the mim-1 promoter". Proceedings of the National Academy of Sciences of the United States of America. 89 (4): 1291–5. Bibcode:1992PNAS...89.1291D. doi:10.1073/pnas.89.4.1291. PMC 48435. PMID 1741383.
  10. ^ Wei G, Schaffner AE, Baker KM, Mansky KC, Ostrowski MC (2003). "Ets-2 interacts with co-repressor BS69 to repress target gene expression". Anticancer Research. 23 (3A): 2173–8. PMID 12894593.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.