HES3

HES3
Identifikatori
AliasiHES3
Vanjski ID-jeviOMIM: 609971 MGI: 104877 HomoloGene: 7358 GeneCards: HES3
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za HES3
Genomska lokacija za HES3
Bend1p36.31Početak6,244,179 bp[1]
Kraj6,245,578 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za HES3
Genomska lokacija za HES3
Bend4 E2|4 83.01 cMPočetak152,370,429 bp[2]
Kraj152,376,119 bp[2]
Ontologija gena
Molekularna funkcija vezivanje sa DNK
transcription factor binding
protein dimerization activity
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001106 transcription corepressor activity
sequence-specific DNA binding
sequence-specific double-stranded DNA binding
Ćelijska komponenta jedro
Biološki proces hindbrain morphogenesis
trochlear nerve development
midbrain-hindbrain boundary morphogenesis
GO:0045996 negative regulation of transcription, DNA-templated
in utero embryonic development
GO:1901227 negative regulation of transcription by RNA polymerase II
GO:0009373 regulation of transcription, DNA-templated
regulation of timing of neuron differentiation
regulation of neurogenesis
oculomotor nerve development
transcription, DNA-templated
midbrain development
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
neural tube development
somitogenesis
Notch signaling pathway
Ćelijska diferencijacija
anterior/posterior pattern specification
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001024598

NM_008237

RefSeq (bjelančevina)

NP_001019769

NP_032263
NP_001390720
NP_001390721
NP_001390722
NP_001390723

Lokacija (UCSC)Chr 1: 6.24 – 6.25 MbChr 4: 152.37 – 152.38 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Transkripcijski faktor 3 Hes porodice bHLH jest protein koji je kod ljudi kodiran genom HES3 sa hromosoma 1.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 186 aminokiselina, a molekulska težina 19.968 Da.[6]

1020304050
MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQ
NSLQGLWPVPRGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAA
GSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGS
SASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000173673 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028946 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Hes family bHLH transcription factor 3".
  6. ^ "UniProt, Q5TGS1" (jezik: eng.). Pristupljeno 28. 11. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura

Vanjski linkovi

Šablon:Transkripcijski faktori i unutarćelijski receptori

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.