STX3

STX3
Identifikatori
AliasiSTX3
Vanjski ID-jeviOMIM: 600876 MGI: 103077 HomoloGene: 80191 GeneCards: STX3
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za STX3
Genomska lokacija za STX3
Bend11q12.1Početak59,713,456 bp[1]
Kraj59,805,882 bp[1]
Lokacija gena (miš)
Hromosom 19 (miš)
Hrom.Hromosom 19 (miš)[2]
Hromosom 19 (miš)
Genomska lokacija za STX3
Genomska lokacija za STX3
Bend19|19 APočetak11,752,482 bp[2]
Kraj11,796,767 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija SNAP receptor activity
GO:0001948, GO:0016582 vezivanje za proteine
arachidonic acid binding
SNARE binding
Ćelijska komponenta integral component of membrane
membrana
cell-cell junction
growth cone
secretory granule
Vakuola
dendrit
SNARE complex
azurophil granule
specific granule
apical plasma membrane
neuron projection
Egzosom
lamellipodium
photoreceptor cell terminal bouton
ribbon synapse
Sinapsna vezikula
presynaptic membrane
Melanosom
zymogen granule membrane
ćelijska membrana
postsynapse
Endomembranski sistem
presynaptic active zone membrane
Schaffer collateral - CA1 synapse
glutamatergic synapse
Biološki proces synaptic vesicle docking
synaptic vesicle fusion to presynaptic active zone membrane
membrane fusion
vesicle docking
positive regulation of protein localization to plasma membrane
positive regulation of chemotaxis
positive regulation of cell population proliferation
positive regulation of protein localization to cell surface
intracellular protein transport
neurotransmitter transport
neuron projection development
vesicle-mediated transport
positive regulation of cell adhesion
Dugoročna potencijacija
Egzocitoza
Fuzija vezikula
exocytic insertion of neurotransmitter receptor to postsynaptic membrane
GO:0015915 transport
cytokine-mediated signaling pathway
vesicle-mediated transport in synapse
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001178040
NM_004177

NM_001025307
NM_001025308
NM_001286543
NM_011502
NM_152220

NM_001360386

RefSeq (bjelančevina)

NP_001171511
NP_004168

NP_001020478
NP_001273472
NP_035632
NP_689344
NP_001347315

Lokacija (UCSC)Chr 11: 59.71 – 59.81 MbChr 19: 11.75 – 11.8 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Sintaksin 3, znan i kao STX3, jest protein[5] koji je kod ljudi kodiran genom STX3 sa hromosoma 11.[6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 289 aminokiselina, a molekulska težina 33.155 Da.[7]

1020304050
MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKIS
EHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEK
HIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQ
RQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKD
IVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDET
KKAVKYQSQARKKLIIIIVLVVVLLGILALIIGLSVGLN

Funkcija

Protein kodiran ovim genom je član porodice sintaksinskih ćelijskih receptora za transport vezikula koji učestvuju u egzocitozi u neutrofilima.[6] STX3 ima važnu ulogu u rastu neurita i služi kao direktna meta za omega-6 arahidonsku kiselinu.[8] Mutacije u sintaksinu 3 uzrokuju bolest inkluzije mikrovilusa.[9]

interakcija

Pokazalo se da sintaksin 3 ima interakcije sa Snap-25,[10][11][12] SNAP23[11][12][13][14] i SNAP29.[12]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000166900 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000041488 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Ibaraki K, Horikawa HP, Morita T, Mori H, Sakimura K, Mishina M, Saisu H, Abe T (juni 1995). "Identification of four different forms of syntaxin 3". Biochem. Biophys. Res. Commun. 211 (3): 997–1005. doi:10.1006/bbrc.1995.1910. PMID 7598732.
  6. ^ a b Martín-Martín B, Nabokina SM, Lazo PA, Mollinedo F (mart 1999). "Co-expression of several human syntaxin genes in neutrophils and differentiating HL-60 cells: variant isoforms and detection of syntaxin 1". J. Leukoc. Biol. 65 (3): 397–406. doi:10.1002/jlb.65.3.397. hdl:10261/59829. PMID 10080545. S2CID 18988377. Arhivirano s originala, 27. 2. 2005. Pristupljeno 15. 4. 2022.
  7. ^ a b "Entrez Gene: STX3 syntaxin 3".
  8. ^ Darios F, Davletov B (april 2006). "Omega-3 and omega-6 fatty acids stimulate cell membrane expansion by acting on syntaxin 3". Nature. 440 (7085): 813–7. Bibcode:2006Natur.440..813D. doi:10.1038/nature04598. PMID 16598260. S2CID 4411524.
  9. ^ Wiegerinck CL, Janecke AR, Schneeberger K, Vogel GF, van Haaften-Visser DY, Escher JC, Adam R, Thöni CE, Pfaller K, Jordan AJ, Weis CA, Nijman IJ, Monroe GR, van Hasselt PM, Cutz E, Klumperman J, Clevers H, Nieuwenhuis EE, Houwen RH, van Haaften G, Hess MW, Huber LA, Stapelbroek JM, Müller T, Middendorp S (2014). "Loss of syntaxin 3 causes variant microvillus inclusion disease". Gastroenterology. 147 (1): 65–68.e10. doi:10.1053/j.gastro.2014.04.002. PMID 24726755.
  10. ^ Hata Y, Südhof TC (Jun 1995). "A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic". J. Biol. Chem. 270 (22): 13022–8. doi:10.1074/jbc.270.22.13022. PMID 7768895.
  11. ^ a b Ravichandran V, Chawla A, Roche PA (Jun 1996). "Identification of a novel syntaxin- and synaptobrevin/VAMP-binding protein, SNAP-23, expressed in non-neuronal tissues". J. Biol. Chem. 271 (23): 13300–3. doi:10.1074/jbc.271.23.13300. PMID 8663154.
  12. ^ a b c Steegmaier M, Yang B, Yoo JS, Huang B, Shen M, Yu S, Luo Y, Scheller RH (Dec 1998). "Three novel proteins of the syntaxin/SNAP-25 family". J. Biol. Chem. 273 (51): 34171–9. doi:10.1074/jbc.273.51.34171. PMID 9852078.
  13. ^ Imai A, Nashida T, Yoshie S, Shimomura H (Aug 2003). "Intracellular localisation of SNARE proteins in rat parotid acinar cells: SNARE complexes on the apical plasma membrane". Arch. Oral Biol. 48 (8): 597–604. doi:10.1016/S0003-9969(03)00116-X. PMID 12828989.
  14. ^ Araki S, Tamori Y, Kawanishi M, Shinoda H, Masugi J, Mori H, Niki T, Okazawa H, Kubota T, Kasuga M (maj 1997). "Inhibition of the binding of SNAP-23 to syntaxin 4 by Munc18c". Biochem. Biophys. Res. Commun. 234 (1): 257–62. doi:10.1006/bbrc.1997.6560. PMID 9168999.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.