STX11

STX11
Identifikatori
AliasiSTX11
Vanjski ID-jeviOMIM: 605014 MGI: 1921982 HomoloGene: 2792 GeneCards: STX11
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za STX11
Genomska lokacija za STX11
Bend6q24.2Početak144,150,517 bp[1]
Kraj144,191,939 bp[1]
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[2]
Hromosom 10 (miš)
Genomska lokacija za STX11
Genomska lokacija za STX11
Bend10|10 A2Početak12,813,953 bp[2]
Kraj12,840,042 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
SNARE binding
SNAP receptor activity
Ćelijska komponenta integral component of membrane
ćelijska membrana
Golđijev aparat
SNARE complex
membrana
Sinapsna vezikula
Endomembranski sistem
presynaptic membrane
presynaptic active zone membrane
Biološki proces protein transport
vesicle docking
synaptic vesicle fusion to presynaptic active zone membrane
membrane fusion
vesicle-mediated transport
intracellular protein transport
Egzocitoza
Fuzija vezikula
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003764

NM_001163590
NM_001163591
NM_029075

RefSeq (bjelančevina)

NP_003755

NP_001157062
NP_001157063
NP_083351

Lokacija (UCSC)Chr 6: 144.15 – 144.19 MbChr 10: 12.81 – 12.84 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Sintaksin 11, znan i kao STX11, jest kod ljudski gen, član porodice t-SNARE.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 287 aminokiselina, a molekulska težina 33.196 Da.[5]

1020304050
MKDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRD
IQDENQLLVADVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVI
HCKLRAMKELSEAAEAQHGPHSAVARISRAQYNALTLTFQRAMHDYNQAE
MKQRDNCKIRIQRQLEIMGKEVSGDQIEDMFEQGKWDVFSENLLADVKGA
RAALNEIESRHRELLRLESRIRDVHELFLQMAVLVEKQADTLNVIELNVQ
KTVDYTGQAKAQVRKAVQYEEKNPCRTLCCFCCPCLK

Interakcije

Pokazalo se da STX11 reaguje sa SNAP25[6][7] i SNAP23.[6][8]

Također pogledajte

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000135604 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000039232 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: STX11 syntaxin 11".
  6. ^ a b Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M (Oct 2005). "Towards a proteome-scale map of the human protein–protein interaction network". Nature. 437 (7062): 1173–8. Bibcode:2005Natur.437.1173R. doi:10.1038/nature04209. PMID 16189514. S2CID 4427026.
  7. ^ Stelzl U, Worm U, Lalowski M, Haenig C, Brembeck FH, Goehler H, Stroedicke M, Zenkner M, Schoenherr A, Koeppen S, Timm J, Mintzlaff S, Abraham C, Bock N, Kietzmann S, Goedde A, Toksöz E, Droege A, Krobitsch S, Korn B, Birchmeier W, Lehrach H, Wanker EE (Sep 2005). "A human protein–protein interaction network: a resource for annotating the proteome". Cell. 122 (6): 957–68. doi:10.1016/j.cell.2005.08.029. hdl:11858/00-001M-0000-0010-8592-0. PMID 16169070. S2CID 8235923.
  8. ^ Valdez AC, Cabaniols JP, Brown MJ, Roche PA (Mar 1999). "Syntaxin 11 is associated with SNAP-23 on late endosomes and the trans-Golgi network". Journal of Cell Science. 112 (6): 845–54. doi:10.1242/jcs.112.6.845. PMID 10036234.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.