STX2

STX2
Identifikatori
AliasiSTX2
Vanjski ID-jeviOMIM: 132350 MGI: 108059 HomoloGene: 37559 GeneCards: STX2
Lokacija gena (čovjek)
Hromosom 12 (čovjek)
Hrom.Hromosom 12 (čovjek)[1]
Hromosom 12 (čovjek)
Genomska lokacija za STX2
Genomska lokacija za STX2
Bend12q24.33Početak130,789,600 bp[1]
Kraj130,839,266 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za STX2
Genomska lokacija za STX2
Bend5 G1.3|5 67.99 cMPočetak129,061,621 bp[2]
Kraj129,085,638 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija protein dimerization activity
SNAP receptor activity
calcium-dependent protein binding
GO:0001948, GO:0016582 vezivanje za proteine
SNARE binding
Ćelijska komponenta integral component of membrane
intracellular membrane-bounded organelle
membrana
Sinapsna vezikula
ćelijska membrana
basolateral plasma membrane
SNARE complex
lamellipodium
Vanćelijsko
Endomembranski sistem
presynaptic membrane
presynaptic active zone membrane
Biološki proces Ćelijska diferencijacija
ectoderm development
synaptic vesicle fusion to presynaptic active zone membrane
response to hydroperoxide
acrosome reaction
vesicle docking
cornified envelope assembly
protein complex oligomerization
animal organ morphogenesis
intracellular protein transport
vesicle-mediated transport
GO:0072468 Transdukcija signala
Egzocitoza
Fuzija vezikula
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001980
NM_194356
NM_001351049
NM_001351050
NM_001351051

NM_001351052

NM_001286033
NM_001286034
NM_007941
NM_001359022

RefSeq (bjelančevina)
NP_001971
NP_919337
NP_001337978
NP_001337979
NP_001337980

NP_001337981

n/a

Lokacija (UCSC)Chr 12: 130.79 – 130.84 MbChr 5: 129.06 – 129.09 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Sintaksin-2, znan i kao epimorfin, jest protein koji je kod ljudi kodiran genom STX2 sa hromosoma 12.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 288 aminokiselina, a molekulska težina 33.341 Da.[7]

1020304050
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYV
EEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFD
QDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQR
QLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD
IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEET
KKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK

Funkcija

Proizvod ovog gena pripada porodici proteina sintaksin/epimorfin. Sintaksini su velika porodica proteina koja je uključena u ciljanje i fuziju međućelijskih transportnih vezikula. Proizvod ovog gena reguliše epitelno-mezenhimske interakcije i morfogenezu i aktivaciju epitelnih ćelija. Identificirane su alternativno prerađene varijante transkripta koje kodiraju različite izoforme.[7] Kada je N-kraj na citosolnoj strani, djeluje kao t-SNARE uključen u spajanje unutarćelijskih vezikula i naziva se sintaksin-2. Kada se okrene iznutra prema van, tj. N kraj visi na vanćelijskoj površini (nekim neklasičnim putem sekrecije) i djeluje kao svestrani morfogen i naziva se epimorfin. Ovaj membranski protein uživa dvostruki izbor drugog oblika topoloških alternativa: ciljanje na apikalnu ili bazolateralnu površinu epitelne ćelije na reguliran način ovisno o različitim kontekstima. Kada se eksprimira mezenhimskim ćelijama, može instruirati epitelnu morfogenezu na epitelnim mezenhimskim sučeljima.

Interakcije

Pokazalo se da STX2 ima interakcije sa:

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000111450 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029428 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Zha H, Remmers EF, Szpirer C, Szpirer J, Zhang H, Kozak CA, Wilder RL (Nov 1996). "The epimorphin gene is highly conserved among humans, mice, and rats and maps to human chromosome 7, mouse chromosome 5, and rat chromosome 12". Genomics. 37 (3): 386–9. doi:10.1006/geno.1996.0574. PMID 8938452.
  6. ^ Band AM, Kuismanen E (Jun 2005). "Localization of plasma membrane t-SNAREs syntaxin 2 and 3 in intracellular compartments". BMC Cell Biology. 6 (1): 26. doi:10.1186/1471-2121-6-26. PMC 1156879. PMID 15943887.
  7. ^ a b c "Entrez Gene: STX2 syntaxin 2".
  8. ^ a b Hata Y, Südhof TC (Jun 1995). "A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic". The Journal of Biological Chemistry. 270 (22): 13022–8. doi:10.1074/jbc.270.22.13022. PMID 7768895.
  9. ^ a b Ravichandran V, Chawla A, Roche PA (Jun 1996). "Identification of a novel syntaxin- and synaptobrevin/VAMP-binding protein, SNAP-23, expressed in non-neuronal tissues". The Journal of Biological Chemistry. 271 (23): 13300–3. doi:10.1074/jbc.271.23.13300. PMID 8663154.
  10. ^ Imai A, Nashida T, Yoshie S, Shimomura H (Aug 2003). "Intracellular localisation of SNARE proteins in rat parotid acinar cells: SNARE complexes on the apical plasma membrane". Archives of Oral Biology. 48 (8): 597–604. doi:10.1016/S0003-9969(03)00116-X. PMID 12828989.
  11. ^ Li G, Alexander EA, Schwartz JH (maj 2003). "Syntaxin isoform specificity in the regulation of renal H+-ATPase exocytosis". The Journal of Biological Chemistry. 278 (22): 19791–7. doi:10.1074/jbc.M212250200. PMID 12651853.
  12. ^ Araki S, Tamori Y, Kawanishi M, Shinoda H, Masugi J, Mori H, Niki T, Okazawa H, Kubota T, Kasuga M (maj 1997). "Inhibition of the binding of SNAP-23 to syntaxin 4 by Munc18c". Biochemical and Biophysical Research Communications. 234 (1): 257–62. doi:10.1006/bbrc.1997.6560. PMID 9168999.
  13. ^ a b Schraw TD, Lemons PP, Dean WL, Whiteheart SW (Aug 2003). "A role for Sec1/Munc18 proteins in platelet exocytosis". The Biochemical Journal. 374 (Pt 1): 207–17. doi:10.1042/BJ20030610. PMC 1223584. PMID 12773094.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.