SMCP

SMCP
Identifikatori
AliasiSMCP
Vanjski ID-jeviOMIM: 601148 MGI: 96945 HomoloGene: 136205 GeneCards: SMCP
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za SMCP
Genomska lokacija za SMCP
Bend1q21.3Početak152,878,322 bp[1]
Kraj152,885,047 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za SMCP
Genomska lokacija za SMCP
Bend3|3 F1Početak92,491,174 bp[2]
Kraj92,496,304 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija• GO:0001948, GO:0016582 vezivanje za proteine
• molekularna funkcija
Ćelijska komponenta• citoplazma
• mitochondrial membranes
• mitohondrija
• membrana
Biološki proces• flagellated sperm motility
• penetration of zona pellucida
• single fertilization
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez

4184

17235

Ensembl

ENSG00000163206

ENSMUSG00000074435

UniProt

P49901

P15265

RefSeq (mRNK)

NM_030663

NM_008574

RefSeq (bjelančevina)

NP_109588

NP_032600

Lokacija (UCSC)Chr 1: 152.88 – 152.89 MbChr 3: 92.49 – 92.5 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Šećerni transporter SWEET1, poznat i kao RAG1-aktivirajući protein 1 i protein ćelijske strome (SMSCP), jest membranski protein koji je kod ljudi kodiran genom SLC50A1 sa hromosoma 1.[5] SWEET1 je jedini transporter iz porodice gena SLC50 (SWEET) prisutan u genomima većine životinjskih vrsta, sa izuzetkom nematode Caenorhabditis elegans, koja ima sedam[6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 221 aminokiselina, a molekulska težina 25.030 Da.[7]

1020304050
MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTT
EVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQ
TATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISMYLSPLADLAK
VIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFI
RFWLFWKYPQEQDRNYWLLQT

Funkcija

SWEET1 je široko eksprimirann transporter glukoze.[6] Kako je porodica SWEET identificirana relativno nedavno, cijeli spektar njenih funkcija kod životinja još nije jasan.[8] Međutim, goveđi homolog SLC50A1 povezan je sa koncentracijom laktoze u mlijeku,[9] a homolog CiRGA u morski om mlazu Ciona intestinalis neophodan je za diferencijaciju tkiva tokom embriogeneze, posebno za razvoj notohorda.[10]

SWEET geni uobičajeni su u biljnim genomima, sa dvadesetak paraloga [6] koji funkcionišu i kao transporteri saharoze i heksoze, a također su povezani i sa osjetljivošću na patogene.[6][11]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000163206 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000074435 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Solute carrier family 50 (sugar efflux transporter), member 1".
  6. ^ a b c d Feng L, Frommer WB (2015). "Structure and function of SemiSWEET and SWEET sugar transporters". Trends in Biochemical Sciences. 40 (8): 480–486. doi:10.1016/j.tibs.2015.05.005. PMID 26071195.
  7. ^ "UniProt, Q9BRV3" (jezik: engleski). Pristupljeno 19. 12. 2021.
  8. ^ Deng D, Yan N (2016). "GLUT, SGLT, and SWEET: Structural and mechanistic investigations of the glucose transporters". Protein Science. 25 (3): 546–558. doi:10.1002/pro.2858. PMC 4815417. PMID 26650681.
  9. ^ Lopdell TJ, T iplady K, Struchalin M, Johnson TJ, Keehan M, Sherlock R, Couldrey C, Davis SR, Snell RG, Spelman RJ, Littlejohn MD (2017). "DNA and RNA-sequence based GWAS highlights membrane-transport genes as key modulators of milk lactose content". BMC Genomics. 18 (1): 968. doi:10.1186/s12864-017-4320-3. PMC 5731188. PMID 29246110. line feed character u |vauthors= na mjestu 14 (pomoć)
  10. ^ Hamada M, Wada S, Kobayashi K, Satoh N (2005). "Ci-Rga, a gene encoding an MtN3/saliva family transmembrane protein, is essential for tissue differentiation during embryogenesis of the ascidian Ciona intestinalis". Differentiation. 73 (7): 364–376. doi:10.1111/j.1432-0436.2005.00037.x. PMID 16219040.
  11. ^ Wright EM (2013). "Glucose transport families SLC5 and SLC50". Molecular Aspects of Medicine. 34 (2–3): 183–196. doi:10.1016/j.mam.2012.11.002. PMID 23506865.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.