GPHA2

GPHA2
Identifikatori
AliasiGPHA2
Vanjski ID-jeviOMIM: 609651 MGI: 2156541 HomoloGene: 15605 GeneCards: GPHA2
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za GPHA2
Genomska lokacija za GPHA2
Bend11q13.1Početak64,934,471 bp[1]
Kraj64,935,893 bp[1]
Lokacija gena (miš)
Hromosom 19 (miš)
Hrom.Hromosom 19 (miš)[2]
Hromosom 19 (miš)
Genomska lokacija za GPHA2
Genomska lokacija za GPHA2
Bend19|19 APočetak6,276,410 bp[2]
Kraj6,277,798 bp[2]
Ontologija gena
Molekularna funkcija hormone activity
thyrotropin-releasing hormone receptor binding
protein heterodimerization activity
GO:0001948, GO:0016582 vezivanje za proteine
hormone receptor binding
Ćelijska komponenta extracellular region
intracellular anatomical structure
Vanćelijsko
Biološki proces cell surface receptor signaling pathway
regulation of signaling receptor activity
G protein-coupled receptor signaling pathway
adenylate cyclase-activating G protein-coupled receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_130769

NM_130453

RefSeq (bjelančevina)

NP_570125

NP_569720

Lokacija (UCSC)Chr 11: 64.93 – 64.94 MbChr 19: 6.28 – 6.28 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Glikoproteinski hormon alfa-2 je protein koji je kod ljudi kodiran genom GPHA2.[5][6]

GPHA2 je polipeptid koji formira cistinski čvor i podjedinica je iz porodice dimernih glikoproteinskih hormona (Hsu et al., 2002, prema OMIM).[6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 129 aminokiselina, a molekulska težina 14.163 Da.[7]

1020304050
MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQG
SHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQ
LQCVGSRREELEIFTARACQCDMCRLSRY

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000149735 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000024784 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Hsu SY, Nakabayashi K, Nishi S, Kumagai J, Kudo M, Sherwood OD, Hsueh AJ (Jan 2002). "Activation of orphan receptors by the hormone relaxin". Science. 295 (5555): 671–4. doi:10.1126/science.1065654. PMID 11809971. S2CID 32693420.
  6. ^ a b "Entrez Gene: GPHA2 glycoprotein hormone alpha 2".
  7. ^ "UniProt, Q96T91". Pristupljeno 22. 8. 2021.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.