THRSP

THRSP
Identifikatori
AliasiTHRSP
Vanjski ID-jeviOMIM: 601926 MGI: 109126 HomoloGene: 2441 GeneCards: THRSP
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za THRSP
Genomska lokacija za THRSP
Bend11q14.1Početak78,063,861 bp[1]
Kraj78,068,351 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za THRSP
Genomska lokacija za THRSP
Bend7|7 E1Početak97,062,145 bp[2]
Kraj97,066,937 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija protein homodimerization activity
vezivanje identičnih proteina
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta citoplazma
jedro
nukleoplazma
citosol
Biološki proces regulation of lipid biosynthetic process
GO:0009373 regulation of transcription, DNA-templated
transcription, DNA-templated
lipid metabolism
regulation of triglyceride biosynthetic process
carnitine shuttle
response to bacterium
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003251

NM_009381

RefSeq (bjelančevina)

NP_003242

NP_033407

Lokacija (UCSC)Chr 11: 78.06 – 78.07 MbChr 7: 97.06 – 97.07 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Tiroidnim hormonom inducibilni jetreni protein je protein koji je kod ljudi kodiran genom THRSP.[5][6]

Protein kodiran ovim genom sličan je genskom proizvodu S14, pacovskog gena, čija je ekspresija ograničena na jetru i masno tkivo i kontrolirana je nutritivnim i hormonskim faktorima.

Pokazalo se da se ovaj gen eksprimira u jetri i adipocitima, posebno u lipomskim modulima. Također je utvrđeno da se eksprimira u lipogenom raku dojke, što ukazuje na ulogu u tumorskoj kontroli metabolizma lipida.[6]

Ranije je THRSP bio među identificiranim reguliranim genima u prefrontalnom korteksu spontano hipertenzivnih pacova (SHR/NCrl) i Wistar-Kyoto (WKY/NCrl) pacova koji su pokazivali ponašanje nepažnje.[7] Nakon toga, prekomjerna ekspresija THRSP-a izazvala je nepažnju, ali ne i hiperaktivno i impulzivno ponašanje miševa, što ukazuje na to da ovaj gen ima ulogu u fenotipu obilježenom nepažnjom ADHD -a.[8]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 146 aminokiselina, а molekulska težina 16.561 Da.[9].

1020304050
MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQ
AEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVED
ESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000151365 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000035686 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Grillasca JP, Gastaldi M, Khiri H, Dace A, Peyrol N, Reynier P, Torresani J, Planells R (Feb 1997). "Cloning and initial characterization of human and mouse Spot 14 genes". FEBS Lett. 401 (1): 38–42. doi:10.1016/S0014-5793(96)01433-0. PMID 9003802. S2CID 44575293.
  6. ^ a b "Entrez Gene: THRSP thyroid hormone responsive (SPOT14 homolog, rat)".
  7. ^ dela Peña, Ike; Bang, Minji; Lee, Jinhee; de la Peña, June Bryan; Kim, Bung-Nyun; Han, Doug Hyun; Noh, Minsoo; Shin, Chan Young; Cheong, Jae Hoon (septembar 2015). "Common prefrontal cortical gene expression profiles between adolescent SHR/NCrl and WKY/NCrl rats which showed inattention behavior". Behavioural Brain Research (jezik: engleski). 291: 268–276. doi:10.1016/j.bbr.2015.05.012. PMID 26048425. S2CID 9853684.
  8. ^ Custodio, Raly James Perez; Botanas, Chrislean Jun; de la Peña, June Bryan; dela Peña, Irene Joy; Kim, Mikyung; Sayson, Leandro Val; Abiero, Arvie; Ryoo, Zae Young; Kim, Bung-Nyun; Kim, Hee Jin; Cheong, Jae Hoon (oktobar 2018). "Overexpression of the Thyroid Hormone-Responsive (THRSP) Gene in the Striatum Leads to the Development of Inattentive-like Phenotype in Mice". Neuroscience (jezik: engleski). 390: 141–150. doi:10.1016/j.neuroscience.2018.08.008. PMID 30138648. S2CID 52075574.
  9. ^ "UniProt, Q92748". Pristupljeno 27. 8. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.