THAP1

THAP1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2JTG, 2KO0, 2L1G

Identifikatori
AliasiTHAP1
Vanjski ID-jeviOMIM: 609520 MGI: 1921004 HomoloGene: 10005 GeneCards: THAP1
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za THAP1
Genomska lokacija za THAP1
Bend8p11.21Početak42,836,674 bp[1]
Kraj42,843,325 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za THAP1
Genomska lokacija za THAP1
Bend8|8 A2Početak26,648,169 bp[2]
Kraj26,654,179 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija vezivanje iona metala
sequence-specific DNA binding
vezivanje sa DNK
vezivanje iona cinka
GO:0001948, GO:0016582 vezivanje za proteine
vezivanje identičnih proteina
nucleic acid binding
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
protein homodimerization activity
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta PML body
intracellular membrane-bounded organelle
jedro
nukleoplazma
fibrillar center
Biološki proces ćelijski ciklus
endothelial cell proliferation
regulation of mitotic cell cycle
transcription, DNA-templated
GO:0009373 regulation of transcription, DNA-templated
GO:1901227 negative regulation of transcription by RNA polymerase II
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_199003
NM_018105

NM_199042

RefSeq (bjelančevina)

NP_060575
NP_945354

NP_950243

Lokacija (UCSC)Chr 8: 42.84 – 42.84 MbChr 8: 26.65 – 26.65 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein 1 sa THAP domenom je protein koji je kod ljudi kodiran genom THAP1. Sinonim je DYT6 (skr. od distonija 6).[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 213 aminokiselina, а molekulska težina 24.944 Da.[8]

1020304050
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKY
SSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQL
PPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIH
QLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVI
LPNDYFEIVEVPA

Funkcija

Protein kodiran ovim genom sadrži THAP-domen, konzervirani domen koji se veže za DNK. Ovaj protein kolociran je s proteinom apoptoznog odgovora PAWR/PAR-4 u jedarnim tijelima promijelocitne leukemije (PML) i funkcionira kao proapoptotski faktor koji povezuje PAWR s jedarnim tijelima PML. Primijećene su alteranivno prerađene varijante transkripta, koje kodiraju različite izoforme.[7]

Interakcije

Pokazano je da THAP1 stupa u interakciju sa PAWR.[6]

Klinički značaj

Protein 1 s domenom [THAP] i apoptozom povezan s tanatosomom (THAP1), protein je koji veže DNK, uzročnikom DYT6 distonije, nasljednim poremećajem kretanja, koji uključuje trajne, nehotične kontrakcije mišića.[9][10]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000131931 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000037214 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Roussigne M, Kossida S, Lavigne AC, Clouaire T, Ecochard V, Glories A, Amalric F, Girard JP (Feb 2003). "The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase". Trends in Biochemical Sciences. 28 (2): 66–9. doi:10.1016/S0968-0004(02)00013-0. PMID 12575992.
  6. ^ a b Roussigne M, Cayrol C, Clouaire T, Amalric F, Girard JP (Apr 2003). "THAP1 is a nuclear proapoptotic factor that links prostate-apoptosis-response-4 (Par-4) to PML nuclear bodies". Oncogene. 22 (16): 2432–42. doi:10.1038/sj.onc.1206271. PMID 12717420.
  7. ^ a b "Entrez Gene: THAP1 THAP domain containing, apoptosis associated protein 1".
  8. ^ "UniProt, Q9NVV9" (jezik: engleski). Pristupljeno 22. 9. 2021.
  9. ^ Fuchs T, Gavarini S, Saunders-Pullman R, Raymond D, Ehrlich ME, Bressman SB, Ozelius LJ (Mar 2009). "Mutations in the THAP1 gene are responsible for DYT6 primary torsion dystonia". Nature Genetics. 41 (3): 286–8. doi:10.1038/ng.304. PMID 19182804. S2CID 205348799.
  10. ^ Cem Sengel, Sophie Gavarini, Nutan Sharma, Laurie J Ozelius, D Cristopher Bragg (2011): Dimerization of the DYT6 dystonia protein, THAP1, requires residues within the coiled-coil domain. Journal of Neurochemistry. 2011 Jul 14;: 21752024

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.