RHOC

RHOC
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1Z2C, 2GCN, 2GCO, 2GCP

Identifikatori
AliasiRHOC
Vanjski ID-jeviOMIM: 165380 MGI: 106028 HomoloGene: 90945 GeneCards: RHOC
EC broj3.6.5.2
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za RHOC
Genomska lokacija za RHOC
Bend1p13.2Početak112,701,127 bp[1]
Kraj112,707,434 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za RHOC
Genomska lokacija za RHOC
Bend3|3 F2.2Početak104,695,691 bp[2]
Kraj104,701,775 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
GTP binding
GO:0001948, GO:0016582 vezivanje za proteine
signal transducer activity
GO:0006184 GTPase activity
Ćelijska komponenta citosol
ćelijska membrana
cleavage furrow
Egzosom
membrana
jedro
intracellular anatomical structure
stereocilium
Biološki proces positive regulation of I-kappaB kinase/NF-kappaB signaling
skeletal muscle satellite cell migration
regulation of small GTPase mediated signal transduction
apical junction assembly
wound healing, spreading of cells
positive regulation of lipase activity
small GTPase mediated signal transduction
positive regulation of protein homooligomerization
mitotic cytokinesis
G protein-coupled receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_175744
NM_001042678
NM_001042679

NM_001291859
NM_007484

RefSeq (bjelančevina)

NP_001036143
NP_001036144
NP_786886

NP_001278788
NP_031510

Lokacija (UCSC)Chr 1: 112.7 – 112.71 MbChr 3: 104.7 – 104.7 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

RhoC (član C Ras porodice genskih homologa) jest mali (~21 kDa) signalni G-protein (GTPaza), koji je kod ljudi kodiran genom RHOCsa hromosoma 1. Član je proteinske porodice Rac, potporodice u porodici Rho porodica GTPaza.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 193 aminokiseline, a molekulska težina 22.006 Da.[7]

1020304050
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDG
KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT
PEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANR
ISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

Mehanizam i funkcija

RhoC je preniliran na svom C-terminalu, i lokalizira se u citoplazmi i plazmamembrani. Smatra se da je važan u pokretljivosti ćelija. Kruži između neaktivnog GDP-vezanog i aktivnog GTP-vezanog stanja i funkcionira kao molekulski prekidač u kaskadama transdukcija signala.

Rho proteini podstiču reorganizaciju aktinskog citoskeleta i regulišu oblik i pokretljivost ćelija. RhoC može aktivirati formine kao što su mDia1 i FMNL2 za remodeliranje citoskeleta.[8][9][10]

Prekomjerna ekspresija RhoC povezana je s proliferacijom ćelija i izazivanjem malignosti tumora.[11] Prouzrokuje degradaciju i rekonstrukciju vanćelijskog matriksa (ECM) koji pomaže ćelijama da migriraju iz tkiva u kojem se trenutno nalaze. Pospješuje pokretljivost ćelija dajući im mogućnost da postanu invazivne.[12] Utvrđeno je da ima direktnu vezu sa uznapredovalim stadijem tumora i metastazama, pri čemu je povećanje stadija povezano sa povećanjem ekspresije RhoC.[13] Miševi s nedostatkom RhoC i dalje mogu razviti tumore, ali oni ne uspijevaju metastazirati, a tvrdu+i se da je RhoC neophodan za metastaze.[14] Također je utvrđeno da pojačava stvaranje angiogenih faktora kao što je VEGF, koji je neophodan da tumor postane maligni.[13][15] In a study by Vega,[16] RhoC was knocked out which resulted in cells spreading out wide in all directions. When RhoC je bio onemogućen, sposobnost ćelije da se kreće u određenom smjeru i migrira bila je narušena. Također je smanjio brzinu kretanja ćelije, jer je bilo teško, a ponekad i nemoguće, polarizirati ćeliju.

Povezani signalni putevi

Ekspresija RhoC-a povezana je sa nekoliko signalnih puteva i efektora. Evo liste do sada pronađenih:

Proučavani tipovi raka sa RhoC

Utvrđeno je da je RhoC prekomjerno izražen u:

Potencijalne terapije

RhoC-ova mala interferirajuća RNK (siRNK) korištena je u studijama za uspješno inhibiranje proliferacije nekih invazivnih karcinoma [17][24] RhoC se može koristiti kao biomarker za procjenu metastatskog potencijala tumora [22][25] Jedna studija je koristila "RhoC shRNK posredovanu rekombinantnim adenovirusom u tandemski povezanoj ekspresiji" za uspješno inhibiranje RhoC[24] Utvrđeno je da ekspresija RhoC nije važna za embriogenezu, već je važna samo za metastaze, što bi ga činilo dobrom metom za liječenje.[15] RhoC ciljana terapija (RV001 od RhoVac) trenutno se testira na raku prostate u tekućem programu kliničke faze 2b u SAD-u i Evropi. Rezultati se očekuju sredinom 2022. (Referenca: https://clinicaltrials.gov/ct2/show/NCT04114825)

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000155366 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000002233 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Ridley A. (2006). "Rho GTPases and actin dynamics in membrane protrusions and vesicle trafficking". Trends Cell Biol. 16 (10): 522–9. doi:10.1016/j.tcb.2006.08.006. PMID 16949823.
  6. ^ "Entrez Gene: RHOC ras homolog gene family, member C".
  7. ^ "UniProt, P08134" (jezik: eng.). Pristupljeno 4. 12. 2021.CS1 održavanje: nepoznati jezik (link)
  8. ^ Kitzing TM, Wang Y, Pertz O, Copeland JW, Grosse R (april 2010). "Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC". Oncogene. 29 (16): 2441–8. doi:10.1038/onc.2009.515. PMID 20101212.
  9. ^ Jaffe AB, Hall A (2005). "Rho GTPases: Biochemistry and Biology". Annual Review of Cell and Developmental Biology. 21: 247–69. doi:10.1146/annurev.cellbio.21.020604.150721. PMID 16212495.
  10. ^ Vega FM, Ridley AJ (2008). "Rho GTPases in Cancer Cell Biology". FEBS Letters. 582 (14): 2093–2101. doi:10.1016/j.febslet.2008.04.039. PMID 18460342.
  11. ^ Horiuchi A, Imai T, Wang C, Ohira S, Feng Y, Nikaido T, Konishi I (juni 2003). "Up-Regulation of Small GTPases, RhoA and RhoC, Is Associated with Tumor Progression in Ovarian Carcinoma". Laboratory Investigation. 83 (6): 861–870. doi:10.1097/01.LAB.0000073128.16098.31. PMID 12808121. S2CID 22119772.
  12. ^ a b Ikoma T, Takahashi T, Nagano S, Li YM, Ohno Y, Ando K, Fujiwara T, Fujiwara H, Kosai K (februar 2004). "A Definitive Role of RhoC in Metastasis of Orthotopic Lung Cancer in Mice". Clinical Cancer Research. 10 (3): 1192–1200. doi:10.1158/1078-0432.ccr-03-0275. PMID 14871999.
  13. ^ a b c d e f g h Zhao Y, Zhi-hong Z, Hui-mian X (2010). "RhoC Expression Level Is Correlated with the Clinicopathological Characteristics of Ovarian Cancer and the Expression Levels of ROCK-I, VEGF, and MMP9". Gynecologic Oncology. 116 (3): 563–71. doi:10.1016/j.ygyno.2009.11.015. PMID 20022093.
  14. ^ Hakem A, Sanchez-Sweatman O, You-Ten A, Duncan G, Wakeham A, Khokha R, Mak TW (septembar 2005). "RhoC is dispensable for embryogenesis and tumor initiation but essential for metastasis". Genes Dev. 19 (17): 1974–9. doi:10.1101/gad.1310805. PMC 1199568. PMID 16107613.
  15. ^ a b c d e f g Srivastava S, Ramdass B, Nagarajan S, Rehman M, Mukherjee G, Krishna S (2010). "Notch1 Regulates the Functional Contribution of RhoC to Cervical Carcinoma Progression". British Journal of Cancer. 102 (1): 196–205. doi:10.1038/sj.bjc.6605451. PMC 2813755. PMID 19953094.
  16. ^ a b Vega FM, Fruhwirth G, Ng T, Ridley AJ (2011). "RhoA and RhoC Have Distinct Roles in Migration and Invasion by Acting through Different Targets". The Journal of Cell Biology. 193 (4): 655–65. doi:10.1083/jcb.201011038. PMC 3166870. PMID 21576392.
  17. ^ a b c Wu Y, Tao Y, Chen Y, Xu W (2012). "RhoC Regulates the Proliferation of Gastric Cancer Cells through Interaction with IQGAP1". PLOS ONE. 7 (11): e48917. doi:10.1371/journal.pone.0048917. PMC 3492142. PMID 23145020.
  18. ^ Genda T, Sakamoto M, Ichida T, Asakura H, Kojiro M, Narumiya S, Hirohashi S (1999). "Cell Motility Mediated by Rho and Rho-Associated Protein Kinase Plays a Critical Role in Intrahepatic Metastasis of Human Hepatocellular Carcinoma". Hepatology. 30 (4): 1027–36. doi:10.1002/hep.510300420. PMID 10498656.
  19. ^ a b Van Golen KL, Bao LW, Pan Q, Miller FR, Wu ZF, Merajver SD (2002). "Mitogen Activated Protein Kinase Pathway Is Involved in RhoC GTPase Induced Motility, Invasion and Angiogenesis in Inflammatory Breast Cancer". Clinical & Experimental Metastasis. 19 (4): 301–11. doi:10.1023/A:1015518114931. hdl:2027.42/42584. PMID 12090470. S2CID 211284.
  20. ^ Sun HW, Tong SL, He J, Wang Q, Zou L, Ma SJ, Tan HY, Luo JF, Wu HX (2007). "RhoA and RhoC -siRNA Inhibit the Proliferation and Invasiveness Activity of Human Gastric Carcinoma by Rho/PI3K/Akt Pathway". World Journal of Gastroenterology. 13 (25): 3517–22. doi:10.3748/wjg.v13.i25.3517. PMC 4146790. PMID 17659701.
  21. ^ a b Iiizumi M, Bandyopadhyay S, Pai SK, Watabe M, Hirota S, Hosobe S, Tsukada T, et al. (2008). "RhoC Promotes Metastasis via Activation of the Pyk2 Pathway in Prostate Cancer". Cancer Research. 68 (18): 7613–20. doi:10.1158/0008-5472.CAN-07-6700. PMC 2741300. PMID 18794150.
  22. ^ a b Kleer CG, Griffith KA, Sabel MS, Gallagher G, van Golen KL, Wu ZF, Merajver SD (2005). "RhoC-GTPase Is a Novel Tissue Biomarker Associated with Biologically Aggressive Carcinomas of the Breast". Breast Cancer Research and Treatment. 93 (2): 101–10. doi:10.1007/s10549-005-4170-6. hdl:2027.42/44231. PMID 16187229. S2CID 9215922.
  23. ^ Wang W, Wu F, Fang F, Tao Y, Yang L (2008). "RhoC Is Essential for Angiogenesis Induced by Hepatocellular Carcinoma Cells via Regulation of Endothelial Cell Organization". Cancer Science. 99 (10): 2012–18. doi:10.1111/j.1349-7006.2008.00902.x. PMID 19016761.
  24. ^ a b c Wang H, Zhao G, Liu X, Sui A, Yang K, Yao R, Wang Z, Shi Q (2010). "Silencing of RhoA and RhoC Expression by RNA Interference Suppresses Human Colorectal Carcinoma Growth in Vivo". Journal of Experimental & Clinical Cancer Research. 29: 123. doi:10.1186/1756-9966-29-123. PMC 2945978. PMID 20828398.
  25. ^ Köbel M, Kalloger SE, Boyd N, McKinney S, Mehl E, Palmer C, Leung S, et al. (2008). "Ovarian Carcinoma Subtypes Are Different Diseases: Implications for Biomarker Studies". PLOS Medicine. 5 (12): e232. doi:10.1371/journal.pmed.0050232. PMC 2592352. PMID 19053170.

Dopunska literatura

Vanjski linkovi

Šablon:Rho porodica GTPaza

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.