MOSC1

MTARC1
Identifikatori
AliasiMTARC1
Vanjski ID-jeviOMIM: 614126 MGI: 1913362 HomoloGene: 129604 GeneCards: MTARC1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za MTARC1
Genomska lokacija za MTARC1
Bend1q41Početak220,786,352 bp[1]
Kraj220,819,659 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za MTARC1
Genomska lokacija za MTARC1
Bend1|1 H5Početak184,518,964 bp[2]
Kraj184,543,510 bp[2]
Ontologija gena
Molekularna funkcija molybdopterin cofactor binding
molybdenum ion binding
oxidoreductase activity
pyridoxal phosphate binding
nitrate reductase activity
catalytic activity
Ćelijska komponenta integral component of membrane
membrana
mitohondrija
mitochondrial outer membrane
Biološki proces detoxification of nitrogen compound
nitrate metabolic process
xenobiotic metabolic process
metabolizam
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_022746

NM_001081361
NM_001290273

RefSeq (bjelančevina)

NP_073583

NP_001277202

Lokacija (UCSC)Chr 1: 220.79 – 220.82 MbChr 1: 184.52 – 184.54 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Mitohondrijska amidoksim-reducirajuća komponenta 1, znana i kao protein 1 sa MOCO sulfuraznim C-terminalnim domenom, MOSC1 ili MARC1, jest enzim koji je kod ljudi kodiran genom sa hromosoma 1.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 337 aminokiselina, a molekulska težina 37.499 Da.[7]

1020304050
MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRR
LLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQE
GNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCR
VHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFR
PKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYA
EDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQC
DPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ

Funkcija

MOCO je engleska skraćenica za molibdenski [[kofaktor (biohemija)|cofaktor.

Prijavljeno je da MOSC1 reducira amidoksime na amidine.[8][9]

Prijavljeno je da su genetičke varijacije MARC1 povezane sa nižim nivoima holesterola u krvi, nivoima jetrenih enzima u krvi, smanjenom masnoćom jetre i zaštitom od ciroze, što sugeriše da nedostatak MARC1 može zaštititi od bolesti jetre.[10]

Također pogledajte

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000186205 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000026621 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Anantharaman V, Aravind L (januar 2002). "MOSC domains: ancient, predicted sulfur-carrier domains, present in diverse metal-sulfur cluster biosynthesis proteins including Molybdenum cofactor sulfurases". FEMS Microbiol. Lett. 207 (1): 55–61. doi:10.1016/S0378-1097(01)00515-8. PMID 11886751.
  6. ^ "Entrez Gene: Mitochondrial amidoxime reducing component 1". Pristupljeno 3. 3. 2016.
  7. ^ "UniProt, Q5VT66" (jezik: engleski). Pristupljeno 14. 12. 2021.
  8. ^ Havemeyer A, Bittner F, Wollers S, Mendel R, Kunze T, Clement B (novembar 2006). "Identification of the missing component in the mitochondrial benzamidoxime prodrug-converting system as a novel molybdenum enzyme". J. Biol. Chem. 281 (46): 34796–802. doi:10.1074/jbc.M607697200. PMID 16973608.
  9. ^ Gruenewald S, Wahl B, Bittner F, Hungeling H, Kanzow S, Kotthaus J, Schwering U, Mendel RR, Clement B (decembar 2008). "The fourth molybdenum containing enzyme mARC: cloning and involvement in the activation of N-hydroxylated prodrugs". J. Med. Chem. 51 (24): 8173–7. doi:10.1021/jm8010417. PMID 19053771.
  10. ^ Kathiresan, Sekar; Gabriel, Stacey; Denny, Joshua; Daly, Mark; Saleheen, Danish; Danesh, John; Gupta, Namrata; Erdmann, Jeanette; Baber, Usman (31. 3. 2019). "A missense variant in Mitochondrial Amidoxime Reducing Component 1 gene and protection against liver disease". bioRxiv (jezik: engleski). 16 (4): 594523. doi:10.1101/594523. PMC 7200007. PMID 32282858.

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.