EPHA2

EPHA2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1MQB, 2E8N, 2K9Y, 2KSO, 2X10, 2X11, 3C8X, 3CZU, 3FL7, 3HEI, 3HPN, 3KKA, 3MBW, 3MX0, 3SKJ, 4P2K, 4PDO, 4TRL, 5EK7

Identifikatori
AliasiEPHA2
Vanjski ID-jeviOMIM: 176946 MGI: 95278 HomoloGene: 20929 GeneCards: EPHA2
EC broj2.7.10.1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za EPHA2
Genomska lokacija za EPHA2
Bend1p36.13Početak16,124,337 bp[1]
Kraj16,156,069 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za EPHA2
Genomska lokacija za EPHA2
Bend4 D3|4 73.67 cMPočetak141,028,551 bp[2]
Kraj141,056,695 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
protein kinase activity
aktivnost sa transferazom
kinase activity
GO:0001948, GO:0016582 vezivanje za proteine
protein tyrosine kinase activity
ATP binding
ephrin receptor activity
transmembrane receptor protein tyrosine kinase activity
cadherin binding
virus receptor activity
transmembrane-ephrin receptor activity
Ćelijska komponenta integral component of membrane
projekcija ćelije
membrana
ruffle membrane
međućelijske veze
lamellipodium membrane
leading edge membrane
focal adhesion
integral component of plasma membrane
intracellular anatomical structure
ćelijska membrana
lamellipodium
cell surface
neuron projection
receptor complex
tight junctions
Biološki proces regulation of lamellipodium assembly
skeletal system development
negative regulation of protein kinase B signaling
Ćelijska diferencijacija
regulation of cell adhesion mediated by integrin
protein kinase B signaling
GO:0032861, GO:0032862, GO:0032856 activation of GTPase activity
Fosforilacija
transmembrane receptor protein tyrosine kinase signaling pathway
keratinocyte differentiation
Vaskulogeneza
multicellular organism development
protein phosphorylation
Ćelijska adhezija
blood vessel development
notochord morphogenesis
notochord cell development
Angiogeneza
intrinsic apoptotic signaling pathway in response to DNA damage
neural tube development
neuron differentiation
Notohord
regulation of ERK1 and ERK2 cascade
cell chemotaxis
post-anal tail morphogenesis
axial mesoderm formation
response to growth factor
GO:0022415 viral process
Ćelijska migracija
GO:0097285 apoptoza
peptidyl-tyrosine phosphorylation
osteoclast differentiation
osteoblast differentiation
regulation of angiogenesis
regulation of blood vessel endothelial cell migration
ephrin receptor signaling pathway
lens fiber cell morphogenesis
mammary gland epithelial cell proliferation
bone remodeling
branching involved in mammary gland duct morphogenesis
GO:0032697 negative regulation of cytokine production
GO:0051637 defense response to Gram-positive bacterium
negative regulation of lymphangiogenesis
blood vessel endothelial cell proliferation involved in sprouting angiogenesis
pericyte cell differentiation
negative regulation of angiogenesis
inflammatory response
negative regulation of chemokine production
blood vessel morphogenesis
cAMP metabolic process
cell motility
viral entry into host cell
positive regulation of protein localization to plasma membrane
axon guidance
protein localization to plasma membrane
positive regulation of bicellular tight junction assembly
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004431
NM_001329090

NM_010139

RefSeq (bjelančevina)

NP_001316019
NP_004422

NP_034269

Lokacija (UCSC)Chr 1: 16.12 – 16.16 MbChr 4: 141.03 – 141.06 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

EPH-receptor A2 (efrinski receptor 2 tip-A ) jest protein koji je kod ljudi kodiran genom EPHA2 sa hromosoma 1.[5][6]

Amiokiselininska sekvenca

Dužina polipeptidnog lanca je 976 aminokiselina, a molekulska težina 108.266 Da.[7]

1020304050
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGK
GWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKF
TVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDEI
TVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKK
CPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVD
GEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTP
PQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVS
DLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTT
SLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPD
TTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAVGVVLLLV
LAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKA
GYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGAL
DKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSN
LVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDV
WSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLM
MQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVR
LPGHQKRIAYSLLGLKDQVNTVGIPI

Funkcija

Ovaj gen pripada potporodici receptora efrinske porodice proteina tirozin-kinaza. EPH i receptori povezani sa EPH su uključeni u posredovanje razvojnih događaja, posebno u nervnom sistemu. Receptori u potporodici EPH tipski imaju jedan domen kinaze i vanćelijsku regiju koja sadrži Cys bogat domen i dva fibronektinska ponavljanja tipa III. Efrinski receptori su podijeljeni u dvije grupe, na osnovu sličnosti njihovih vanćelijskih domenskih sekvenci i njihovih afiniteta za vezivanje liganda efrina-A i efrina-B. Ovaj gen kodira protein koji veže ligande za efrin-A.[6]

Klinički značaj

Može biti upleten u BRAF mutirani melanom koji postaje otporan na BRAF inhibitore i MEK inhibitor.[8] Također je receptor putem kojeg Kaposi sarkomu-pridruženi herpesvirus (KSHV) ulazi u ćelije domaćina; mala molekula inhibitora EphA2 pokazuje izvjesnu sposobnost blokiranja ulaska KSHV u ljudske ćelije.[9]

Interakcije

Pokazalo se da je EPH receptor A2 u interakciji sa:

Takođe je pokazano da je doksazosin mali molekulski agonist EPH receptora A2.[14]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000142627 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000006445 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Sulman EP, Tang XX, Allen C, Biegel JA, Pleasure DE, Brodeur GM, Ikegaki N (april 1997). "ECK, a human EPH-related gene, maps to 1p36.1, a common region of alteration in human cancers". Genomics. 40 (2): 371–4. doi:10.1006/geno.1996.4569. PMID 9119409.
  6. ^ a b "Entrez Gene: EPHA2 EPH receptor A2".
  7. ^ "UniProt, P29317" (jezik: engleski). Pristupljeno 15. 11. 2021.
  8. ^ "Counteracting Drug Resistance in Melanoma". 2015. Arhivirano s originala, 4. 2. 2015. Pristupljeno 25. 11. 2021.
  9. ^ Hahn AS, Kaufmann JK, Wies E, Naschberger E, Panteleev-Ivlev J, Schmidt K, Holzer A, Schmidt M, Chen J, König S, Ensser A, Myoung J, Brockmeyer NH, Stürzl M, Fleckenstein B, Neipel F (2012). "The ephrin receptor tyrosine kinase A2 is a cellular receptor for Kaposi's sarcoma–associated herpesvirus". Nat. Med. 18 (6): 961–6. doi:10.1038/nm.2805. PMC 3645317. PMID 22635007.
  10. ^ Himanen JP, Goldgur Y, Miao H, Myshkin E, Guo H, Buck M, Nguyen M, Rajashankar KR, Wang BC, Nikolov DB (juli 2009). "Ligand recognition by A-class Eph receptors: crystal structures of the EphA2 ligand-binding domain and the EphA2/ephrin-A1 complex". EMBO Rep. 10 (7): 722–8. doi:10.1038/embor.2009.91. PMC 2727437. PMID 19525919.
  11. ^ Kikawa KD, Vidale DR, Van Etten RL, Kinch MS (oktobar 2002). "Regulation of the EphA2 kinase by the low molecular weight tyrosine phosphatase induces transformation". J. Biol. Chem. 277 (42): 39274–9. doi:10.1074/jbc.M207127200. PMID 12167657.
  12. ^ a b Pratt RL, Kinch MS (oktobar 2002). "Activation of the EphA2 tyrosine kinase stimulates the MAP/ERK kinase signaling cascade". Oncogene. 21 (50): 7690–9. doi:10.1038/sj.onc.1205758. PMID 12400011.
  13. ^ Pandey A, Lazar DF, Saltiel AR, Dixit VM (decembar 1994). "Activation of the Eck receptor protein tyrosine kinase stimulates phosphatidylinositol 3-kinase activity". J. Biol. Chem. 269 (48): 30154–7. doi:10.1016/S0021-9258(18)43790-8. PMID 7982920.
  14. ^ Petty A, Myshkin E, Qin H, Guo H, Miao H, Tochtrop GP, Hsieh JT, Page P, Liu L, Lindner DJ, Acharya C, MacKerell AD, Ficker E, Song J, Wang BC (august 2012). "A small molecule agonist of EphA2 receptor tyrosine kinase inhibits tumor cell migration in vitro and prostate cancer metastasis in vivo". PLOS ONE. 7 (8): e42120. doi:10.1371/journal.pone.0042120. PMC 3419725. PMID 22916121.

Dopunska literatura

Vanjski linkovi


Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.