SHC1

SHC1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1MIL, 1N3H, 1OY2, 1QG1, 1SHC, 1TCE, 2L1C, 4JMH, 4XWX, 5CZI

Identifikatori
AliasiSHC1
Vanjski ID-jeviOMIM: 600560 MGI: 98296 HomoloGene: 7934 GeneCards: SHC1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za SHC1
Genomska lokacija za SHC1
Bend1q21.3Početak154,962,298 bp[1]
Kraj154,974,395 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za SHC1
Genomska lokacija za SHC1
Bend3 F1|3 39.11 cMPočetak89,325,750 bp[2]
Kraj89,337,334 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija insulin-like growth factor receptor binding
transmembrane receptor protein tyrosine kinase adaptor activity
insulin receptor binding
neurotrophin TRKA receptor binding
ephrin receptor binding
epidermal growth factor receptor binding
receptor tyrosine kinase binding
GO:0001948, GO:0016582 vezivanje za proteine
phospholipid binding
epidermal growth factor binding
phosphotyrosine residue binding
Ćelijska komponenta citoplazma
citosol
mitochondrial matrix
mitohondrija
Shc-EGFR complex
ćelijska membrana
Biološki proces actin cytoskeleton reorganization
GO:1901047 insulin receptor signaling pathway
GO:0007243 intracellular signal transduction
epidermal growth factor receptor signaling pathway
cellular response to growth factor stimulus
MAPK cascade
Fc-epsilon receptor signaling pathway
development of the heart
IRE1-mediated unfolded protein response
regulation of cell population proliferation
Angiogeneza
regulation of epidermal growth factor-activated receptor activity
regulation of growth
Ras protein signal transduction
GO:0022415 viral process
leukocyte migration
GO:0072468 Transdukcija signala
ERBB2 signaling pathway
axon guidance
defense response to bacterium
negative regulation of apoptotic process
positive regulation of MAPK cascade
GO:0045996 negative regulation of transcription, DNA-templated
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
positive regulation of ERK1 and ERK2 cascade
cell-cell adhesion
interleukin-15-mediated signaling pathway
negative regulation of angiogenesis
cytokine-mediated signaling pathway
interleukin-2-mediated signaling pathway
positive regulation of cell proliferation in bone marrow
regulation of superoxide metabolic process
positive regulation of cell population proliferation
positive regulation of Ras protein signal transduction
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001130040
NM_001130041
NM_001202859
NM_003029
NM_183001

NM_001113331
NM_011368

RefSeq (bjelančevina)

NP_001123512
NP_001123513
NP_001189788
NP_003020
NP_892113

NP_001106802
NP_035498

Lokacija (UCSC)Chr 1: 154.96 – 154.97 MbChr 3: 89.33 – 89.34 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

SHC-transformirajući protein 1 jest protein koji je kod ljudi kodiran genom SHC1 sa hromosoma 1.[5] Za SHC nađeno je da je u sisarskim ćelijama važan u regulaciji apoptoza i rezistenciji na lijekove.

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 583 aminokiseline, a molekulska težina 62.822 Da.[6]

1020304050
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLP
GDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMP
DSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLH
PNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVP
GAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQ
IIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYY
NDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPV
GGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAI
NGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLSRREAEA
LLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFE
SVSHLISYHMDNHLPIISAGSELCLQQPVERKL

SCOP klasifikuje 3D strukturu kao pripadnost porodici SH2-domena.

Gen i ekspresija

Gen SHC1 nalazi se na hromosomu 1 i kodira tri glavne izoforme proteina: p66SHC, p52SHC i p46SHC. Ovi proteini se razlikuju po aktivnosti i subćelijskoj lokaciji, p66 je najduži i dok p52 i p46 povezuju aktiviranu receptorsku tirozin kinazu na RAS putu.[7] The protein SHC1 also acts as a scaffold protein which is used in cell surface receptors.[8] The three proteins that SHC1 codes for have distinctly different molecular weights.[9] All three SHC1 proteins share the same domain arrangement consisting of an N-terminal phosphotyrosine-binding(PTB) domain and a C-terminal Src-homology2(SH2) domain. Both of the domains for the three proteins can bind to tyrosine-phosphorylated proteins but they are different in their phosphopeptide-binding specificities.[10] P66SHC is characterized by having an additional N-terminal CH2 domain.[10]

Funkcija

Prekomjerna ekspresija SHC proteina povezana je sa mitogenezom raka, karcinogenezom i metastazama.[9] SHC i njegovi adapterski proteini prenose signalizaciju receptora na površini ćelije kao što su EGFR, erbV-2 i insulinski receptori. p52SHC i p46SHC aktiviraju Ras-ERK put. p66SHC inhibira aktivnost ERK1/2 i antagonizira mitogenu sposobnost i sposobnost preživljavanja Jurkat ćelijskih linija T-limfoma.[9] Porast p66SHC podstiče apoptoze izazvane stresom. Također je uključen u oksidativna i stresom izazvana apoptozom– posredovana djelovanja steroida, putem redoks signalnog puta. P52SHC i p66SHC pronađeni su u karcinomu i metastazama reguliranim steroidnim hormonima.

SHC-transformirajuči protein 1 ima raznolike funkcije u više područja,kao što su

Klinički značaj

Aktivacija signala SHC-a uključena je u tumorigenost u ćelijama raka, a postoji potencijal da se SHC koristi kao prognostički marker kada se cilja na liječenje kancera.[9] SHC1 interacts with SgK269 which is a member of the Src kinase signaling network that characterized basal breast cancer cells. When SgK269 is overexpressed in mammary epithelial cells it promotes the cell growth and might contribute to the progression of aggressive breast cancers.[11] Čini se da kod raka prostate i jajnika povećana ekspresija p66Shc podstiče proliferaciju ćelija.[12] i tumorigenost, posebno kod ksenotransplanta raka prostate [13] Ovaj tumorogeni efekat je povezan sa njegovom sposobnošću da poveća redoksni stres u ovim ćelijama raka.[14]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000160691 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000042626 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Pelicci G, Lanfrancone L, Grignani F, McGlade J, Cavallo F, Forni G, Nicoletti I, Grignani F, Pawson T, Pelicci PG (Jul 1992). "A novel transforming protein (SHC) with an SH2 domain is implicated in mitogenic signal transduction". Cell. 70 (1): 93–104. doi:10.1016/0092-8674(92)90536-L. PMID 1623525. S2CID 20390181.
  6. ^ "UniProt, P29353" (jezik: engleski). Pristupljeno 18. 12. 2021.
  7. ^ "Genes and Mapped Phenotypes". National Center for Biotechnology Information. US National Library of Medicine.
  8. ^ Zheng Y, Zhang C, Croucher DR, Soliman MA, St-Denis N, Pasculescu A, Taylor L, Tate SA, Hardy WR, Colwill K, Dai AY, Bagshaw R, Dennis JW, Gingras AC, Daly RJ, Pawson T (Jul 2013). "Temporal regulation of EGF signalling networks by the scaffold protein Shc1". Nature. 499 (7457): 166–71. Bibcode:2013Natur.499..166Z. doi:10.1038/nature12308. PMC 4931914. PMID 23846654.
  9. ^ a b c d Shih HJ, Chen HH, Chen YA, Wu MH, Liou GG, Chang WW, Chen L, Wang LH, Hsu HL (Nov 2012). "Targeting MCT-1 oncogene inhibits Shc pathway and xenograft tumorigenicity". Oncotarget. 3 (11): 1401–15. doi:10.18632/oncotarget.688. PMC 3717801. PMID 23211466.
  10. ^ a b Neumann-Haefelin E, Qi W, Finkbeiner E, Walz G, Baumeister R, Hertweck M (Oct 2008). "SHC-1/p52Shc targets the insulin/IGF-1 and JNK signaling pathways to modulate life span and stress response in C. elegans". Genes & Development. 22 (19): 2721–35. doi:10.1101/gad.478408. PMC 2559911. PMID 18832074.
  11. ^ Dikic I, Daly RJ (Mar 2012). "Signalling through the grapevine". EMBO Reports. 13 (3): 178–80. doi:10.1038/embor.2012.16. PMC 3323131. PMID 22354089.
  12. ^ Bhat SS, Anand D, Khanday FA (2015). "p66Shc as a switch in bringing about contrasting responses in cell growth: implications on cell proliferation and apoptosis". Molecular Cancer. 14: 76. doi:10.1186/s12943-015-0354-9. PMC 4421994. PMID 25890053.
  13. ^ Veeramani S, Chou YW, Lin FC, Muniyan S, Lin FF, Kumar S, Xie Y, Lele SM, Tu Y, Lin MF (juli 2012). "Reactive oxygen species induced by p66Shc longevity protein mediate nongenomic androgen action via tyrosine phosphorylation signaling to enhance tumorigenicity of prostate cancer cells". Free Radical Biology & Medicine. 53 (1): 95–108. doi:10.1016/j.freeradbiomed.2012.03.024. PMC 3384717. PMID 22561705.
  14. ^ Lebiedzinska-Arciszewska M, Oparka M, Vega-Naredo I, Karkucinska-Wieckowska A, Pinton P, Duszynski J, Wieckowski MR (2015). "The interplay between p66Shc, reactive oxygen species and cancer cell metabolism". European Journal of Clinical Investigation. 45 Suppl 1: 25–31. doi:10.1111/eci.12364. PMID 25524583. S2CID 18237773.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.