CCL3

CCL3
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1B50, 1B53, 2X69, 2X6G, 3FPU, 3H44, 3KBX, 4RA8, 4ZKB, 5D65, 5COR

Identifikatori
AliasiCCL3
Vanjski ID-jeviOMIM: 182283 MGI: 98260 HomoloGene: 88430 GeneCards: CCL3
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za CCL3
Genomska lokacija za CCL3
Bend17q12Početak36,088,256 bp[1]
Kraj36,090,169 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za CCL3
Genomska lokacija za CCL3
Bend11 C|11 51.04 cMPočetak83,538,670 bp[2]
Kraj83,540,181 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija protein kinase activity
cytokine activity
CCR5 chemokine receptor binding
chemokine activity
CCR1 chemokine receptor binding
kinase activity
phospholipase activator activity
calcium-dependent protein kinase C activity
GO:0001948, GO:0016582 vezivanje za proteine
vezivanje identičnih proteina
chemoattractant activity
CCR chemokine receptor binding
Ćelijska komponenta citoplazma
citosol
intracellular anatomical structure
extracellular region
Vanćelijsko
Biološki proces G protein-coupled receptor signaling pathway
signaling
negative regulation of bone mineralization
positive regulation of protein kinase B signaling
release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
response to cholesterol
positive regulation of calcium-mediated signaling
regulation of sensory perception of pain
protein kinase B signaling
monocyte chemotaxis
negative regulation of osteoclast differentiation
astrocyte cell migration
positive regulation of cell migration
positive regulation of natural killer cell chemotaxis
chemokine-mediated signaling pathway
T cell chemotaxis
cell-cell signaling
cellular response to tumor necrosis factor
eosinophil chemotaxis
GO:1904579 cellular response to organic cyclic compound
cellular calcium ion homeostasis
negative regulation of gene expression
neutrophil chemotaxis
cell activation
MAPK cascade
Hemotaksija
GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
positive regulation of neuron apoptotic process
positive regulation of calcium ion import
macrophage chemotaxis
GO:1901313 positive regulation of gene expression
cytoskeleton organization
osteoblast differentiation
cellular response to interleukin-1
GO:0046730, GO:0046737, GO:0046738, GO:0046736 Imuni odgovor
positive regulation of ERK1 and ERK2 cascade
regulation of cell shape
positive regulation of tumor necrosis factor production
cellular response to interferon-gamma
lymphocyte chemotaxis
inflammatory response
granulocyte chemotaxis
response to toxic substance
eosinophil degranulation
lipopolysaccharide-mediated signaling pathway
calcium ion transport
calcium-mediated signaling
Egzocitoza
positive regulation of calcium ion transport
positive chemotaxis
positive regulation of inflammatory response
regulation of signaling receptor activity
cytokine-mediated signaling pathway
regulation of behavior
positive regulation of microglial cell activation
positive regulation of microglial cell migration
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_002983

NM_011337

RefSeq (bjelančevina)

NP_002974

NP_035467

Lokacija (UCSC)Chr 17: 36.09 – 36.09 MbChr 11: 83.54 – 83.54 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Hemokinski (C-C motivni) ligand 3 (CCL3), znan i kao makrofagni upalni protein 1-alfa (MIP-1-alfa) je protein koji je kod ljudi kodiran genom CCL.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 92 aminokiseline, a molekulska težina 10.085 Da.[6].

Simboli
1020304050
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADY
FETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Funkcija

CCL3 je citokin koji pripada porodici CC hemokina koji su uključeni u akutno upalno stanje u regrutovanju i aktivaciji polimorfojedarnih leukocita[7] vezanjem na receptore CCR1, CCR4 i CCR5.[5]

Sherry et al. (1988) demonstrirali su dvije proteinske komponente MIP1, koje se nazivaju alfa (CCL3, ovaj protein) i beta (CCL4).[5][8]

CCL3 izaziva monofaznu groznicu brzog početka, čija je magnituda jednaka ili veća od groznice proizvedene bilo s rekombinantnim ljudskim faktorom nekroze tumora ili rekombinantnim ljudskim interleukinom-1. Međutim, za razliku od ova dva endogena pirogena, inhibitor ciklooksigenaza ibuprofen inhibitor ibuprofen ne može inhibirati groznicu izazvanu MIP-1, a CCL3 može učestvovati u upalnim odgovorom koji nije posredovan sintezom prostaglandina i klinički se ne može ablirati ciklooksigenazom.[9]

Interakcije

Pokazano je da CCL3 komunicira sa CCL4.[10] Privlači makrofage, monocite i neutrofile.

Također pogledajte

Reference

  1. ^ a b c ENSG00000277632, ENSG00000274221 GRCh38: Ensembl release 89: ENSG00000278567, ENSG00000277632, ENSG00000274221 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000000982 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c "Entrez Gene: CCL3 chemokine (C-C motif) ligand 3".
  6. ^ "UniProt, P10147". Pristupljeno 26. 6. 2021.
  7. ^ Wolpe SD, Davatelis G, Sherry B, Beutler B, Hesse DG, Nguyen HT, Moldawer LL, Nathan CF, Lowry SF, Cerami A (1988). "Macrophages secrete a novel heparin-binding protein with inflammatory and neutrophil chemokinetic properties". The Journal of Experimental Medicine. 167 (2): 570–81. doi:10.1084/jem.167.2.570. PMC 2188834. PMID 3279154.
  8. ^ Sherry B, Tekamp-Olson P, Gallegos C, Bauer D, Davatelis G, Wolpe SD, Masiarz F, Coit D, Cerami A (1988). "Resolution of the two components of macrophage inflammatory protein 1, and cloning and characterization of one of those components, macrophage inflammatory protein 1 beta". The Journal of Experimental Medicine. 168 (6): 2251–9. doi:10.1084/jem.168.6.2251. PMC 2189160. PMID 3058856.
  9. ^ Davatelis G, Wolpe SD, Sherry B, Dayer JM, Chicheportiche R, Cerami A (1989). "Macrophage inflammatory protein-1: a prostaglandin-independent endogenous pyrogen". Science. 243 (4894 Pt 1): 1066–8. doi:10.1126/science.2646711. PMID 2646711.
  10. ^ Guan E, Wang J, Norcross MA (Apr 2001). "Identification of human macrophage inflammatory proteins 1alpha and 1beta as a native secreted heterodimer". The Journal of Biological Chemistry. 276 (15): 12404–9. doi:10.1074/jbc.M006327200. PMID 11278300.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.