BMPR2

BMPR2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2HLQ, 3G2F

Identifikatori
AliasiBMPR2
Vanjski ID-jeviOMIM: 600799 MGI: 1095407 HomoloGene: 929 GeneCards: BMPR2
EC broj2.7.11.30
Lokacija gena (čovjek)
Hromosom 2 (čovjek)
Hrom.Hromosom 2 (čovjek)[1]
Hromosom 2 (čovjek)
Genomska lokacija za BMPR2
Genomska lokacija za BMPR2
Bend2q33.1-q33.2Početak202,376,327 bp[1]
Kraj202,567,751 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za BMPR2
Genomska lokacija za BMPR2
Bend1|1 C2Početak59,802,559 bp[2]
Kraj59,918,173 bp[2]
Ontologija gena
Molekularna funkcija transmembrane receptor protein serine/threonine kinase activity
ATP binding
protein serine/threonine kinase activity
activin receptor activity, type II
BMP binding
protein kinase activity
GO:0001948, GO:0016582 vezivanje za proteine
kinase activity
growth factor binding
vezivanje iona metala
nucleotide binding
aktivnost sa transferazom
BMP receptor activity
transforming growth factor beta-activated receptor activity
transforming growth factor beta receptor activity, type II
SMAD binding
Ćelijska komponenta integral component of membrane
Kaveole
spanning component of plasma membrane
dendrit
soma
membrana
cell surface
integral component of plasma membrane
ćelijska membrana
citoplazma
basal plasma membrane
apical plasma membrane
Vanćelijsko
nukleoplazma
GO:0097483, GO:0097481 postsynaptic density
receptor complex
Biološki proces endothelial cell apoptotic process
positive regulation of epithelial cell migration
transmembrane receptor protein serine/threonine kinase signaling pathway
negative regulation of vasoconstriction
positive regulation of endothelial cell proliferation
endochondral bone morphogenesis
positive regulation of endothelial cell migration
lymphangiogenesis
positive regulation of pathway-restricted SMAD protein phosphorylation
anterior/posterior pattern specification
regulation of cell population proliferation
lung alveolus development
negative regulation of cell growth
transcription by RNA polymerase II
regulation of lung blood pressure
protein phosphorylation
positive regulation of axon extension involved in axon guidance
artery development
blood vessel remodeling
BMP signaling pathway
mesoderm formation
vascular endothelial growth factor receptor signaling pathway
GO:0072468 Transdukcija signala
proteoglycan biosynthetic process
positive regulation of cartilage development
maternal placenta development
endothelial cell proliferation
cellular response to starvation
negative regulation of DNA biosynthetic process
chondrocyte development
negative regulation of systemic arterial blood pressure
positive regulation of osteoblast differentiation
retina vasculature development in camera-type eye
cellular response to BMP stimulus
Fosforilacija
venous blood vessel development
brain development
retina development in camera-type eye
positive regulation of BMP signaling pathway
limb development
positive regulation of bone mineralization
negative regulation of chondrocyte proliferation
lymphatic endothelial cell differentiation
mitral valve morphogenesis
pharyngeal arch artery morphogenesis
tricuspid valve morphogenesis
outflow tract septum morphogenesis
atrioventricular valve morphogenesis
activin receptor signaling pathway
cardiac muscle tissue development
outflow tract morphogenesis
endocardial cushion development
negative regulation of cell proliferation involved in heart valve morphogenesis
positive regulation of ossification
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
ventricular septum morphogenesis
atrial septum morphogenesis
semi-lunar valve development
transforming growth factor beta receptor signaling pathway
pattern specification process
aortic valve development
pulmonary valve development
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001204
NM_033346

NM_007561

RefSeq (bjelančevina)

NP_001195

NP_031587

Lokacija (UCSC)Chr 2: 202.38 – 202.57 MbChr 1: 59.8 – 59.92 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Receptor koštanog morfogenetskog proteina tip II ili jest enzim koji je kod ljudi kodiran genom BMPR2 sa hromosoma 2. To je serin/treonin receptor kinaza za vezanje koštane morfogenetske prpteine, članove TGF beta liganada, konatporodice liganada ji uključenih u parakrinu signalizaciju. BMP učestvuju u nizu ćelijskih funkcija, uključujući osteogenezu, ćelijski rast i diferencijaciju. Signalizacija u BMP-putu počinje vezivanjem BMP-a za receptor tipa II. Ovo uzrokuje regrutaciju BMP tipa I receptora, koji fosforilizira. Receptor tipa I fosforilira regulator transkripcije R-SMAD.

Amiokiselininska sekvenca

Dužina polipeptidnog lanca je 1 038 aminokiselina, a molekulska težina 115.201 Da.[5]

1020304050
MTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESR
ISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECV
VTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDET
IIIALASVSVLAVLIVALCFGYRMLTGDRKQGLHSMNMMEAAASEPSLDL
DNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVP
LMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVIS
DFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESA
LKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQ
VLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEER
MAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKIGPYPDYSSSS
YIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETNLHTTNVAQSIG
PTPVCLQLTEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLS
STSSSLLYPLIKLAVEATGQQDFTQTANGQACLIPDVLPTQIYPLPKQQN
LPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPH
VVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQ
FIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLD
GSSIQIGESTQDGKSGSGEKIKKRVKTPYSLKRWRPSTWVISTESLDCEV
NNNGSNRAVHSKSSTAVYLAEGGTATTMVSKDIGMNCL

Funkcija

Za razliku od TGFβ receptora tipa II, koji ima visok afinitet za TGF-β1, BMPR2 nema visok afinitet za BMP-2, BMP-7 i BMP-4, osim ako nije ko-eksprimiran s BMP receptorom tipa I. Vezanjem liganda, formira receptorski kompleks koji se sastoji od dvije transmembrane tipa II i dvije serin/treonin-kinaze tipa I. Receptori tipa II fosforiliraju i aktiviraju receptore tipa I koji zatim autofosforilirajući vežu i aktiviraju SMAD transkripcijske regulatore. Veže se za BMP-7, BMP-2 i, manje efikasno, za BMP-4. Vezivanje je slabo, ali pojačano prisustvom receptora tipa I za BMP.[6] U TGF-beta signalizaciji svi receptori postoje u homodimerima prije vezivanja liganda. U slučaju receptora BMP, samo mali dio receptora postoji u homomernim oblicima prije vezivanja ligand. Jednom kada se ligand veže za receptor, povećava se količina oligomera homomernih receptora, što sugerira da se ravnoteža pomjera prema homodimernom obliku. Nizak afinitet za ligande sugerira da BMPR2 se može razlikovati od drugih TGF beta receptora tipa II po tome što ligand može prvo vezati receptor tipa I.[7]

Razvoj oocita

BMPR2 se eksprimira i na ljudskim i na životinjskim granuloznim ćelijama i ključni je receptor za koštani morfogenetski protein 15 (BMP15) i faktor diferencijacije rasta 9 (GDF 9). Ove dvije proteinske signalne molekule i njihovi BMPR2 posredovani efekti imaju važnu ulogu u razvoju folikula u pripremi za ovulaciju.[8] Međutim, BMPR2 ne može da veže BMP15 i GDF9 bez pomoći receptora koštanog morfogenetskog proteina 1B (BMPR1B) i receptora 1 transformacijskog faktora rasta β (TGFβR1). Postoje dokazi da je BMPR2 signalni put poremećen u slučaju sindroma policistastih jajnika, vjerovatno hiperaldosterizmom.[9]

Čini se da hormoni estrogen i folikul-stimulirajući hormon (FSH) imaju ulogu u regulaciji ekspresije BMPR2 u granuloza ćelijamama. Eksperimentalni tretman na životinjskim modelima sa estradiolom sa ili bez FSH povećao je ekspresiju iRNK BMPR2, dok je tretman samim FSH smanjio ekspresiju BMPR2. Međutim, kod ljudskih ćelija tumora sličnih granulozi (KGN), tretman sa FSH povećao je ekspresiju BMPR2.[10]

Klinički značaj

Inaktivirajuća mutacija u "BMPR2" genu je povezana sa plućnom arterijskom hipertenzijom.[11]

BMPR2 djeluje tako da inhibira proliferaciju vaskularnog glatkog mišićnog tkiva. Djeluje tako što podstiče preživljavanje endotelnih ćelija plućnih arterija, čime sprečava oštećenje arterija i štetne upalne reakcije. Također inhibira proliferaciju plućnih arterija, kao odgovor na faktore rasta, što sprečava zatvaranje arterija proliferacijom endotelnih ćelija.[12] Kada se ovaj gen inhibira, glatki mišići krvnih sudova proliferiraju i mogu uzrokovati plućnu hipertenziju, što, između ostalog, može dovesti do poremećaja cor pulmonale, stanja koje uzrokuje otkazivanje desne strane srca. Disfunkcija BMPR2 također može dovesti do povišenja plućnog arterijskog pritiska zbog štetnog odgovora plućnog kola na ozljedu.[12]

Posebno je važno pregledati mutacije BMPR2 kod srodnika pacijenata sa idiopatskom plućnom hipertenzijom, jer su ove mutacije prisutne u >70% porodičnih slučajeva.[12]

Postojale su studije koje su povezivale BMPR2 s povećanjem pritiska PA ,uzrokovanog vježbanjem mjerenjem brzine trokvržične regurgitacije ehokardiografijom.[13]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000204217 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000067336 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "UniProt, Q13873" (jezik: engleski). Pristupljeno 16. 11. 2021.
  6. ^ Gilboa L, Nohe A, Geissendörfer T, Sebald W, Henis YI, Knaus P (mart 2000). "Bone morphogenetic protein receptor complexes on the surface of live cells: a new oligomerization mode for serine/threonine kinase receptors". Mol. Biol. Cell. 11 (3): 1023–35. doi:10.1091/mbc.11.3.1023. PMC 14828. PMID 10712517.
  7. ^ Kirsch T, Nickel J, Sebald W (juli 2000). "BMP-2 antagonists emerge from alterations in the low-affinity binding epitope for receptor BMPR-II". EMBO J. 19 (13): 3314–24. doi:10.1093/emboj/19.13.3314. PMC 313944. PMID 10880444.
  8. ^ Edwards SJ, Reader KL, Lun S, Western A, Lawrence S, McNatty KP, Juengel JL (2008). "The cooperative effect of growth and differentiation factor-9 and bone morphogenetic protein (BMP)-15 on granulosa cell function is modulated primarily through BMP receptor II". Endocrinology. 149 (3): 1026–30. doi:10.1210/en.2007-1328. PMID 18063682.
  9. ^ de Resende LO, Vireque AA, Santana LF, Moreno DA, de Sá Rosa e Silva AC, Ferriani RA, Scrideli CA, Reis RM (2012). "Single-cell expression analysis of BMP15 and GDF9 in mature oocytes and BMPR2 in cumulus cells of women with polycystic ovary syndrome undergoing controlled ovarian hyperstimulation". J. Assist. Reprod. Genet. 29 (10): 1057–65. doi:10.1007/s10815-012-9825-8. PMC 3492567. PMID 22825968.
  10. ^ Paradis F, Novak S, Murdoch GK, Dyck MK, Dixon WT, Foxcroft GR (2009). "Temporal regulation of BMP2, BMP6, BMP15, GDF9, BMPR1A, BMPR1B, BMPR2 and TGFBR1 mRNA expression in the oocyte, granulosa and theca cells of developing preovulatory follicles in the pig". Reproduction. 138 (1): 115–29. doi:10.1530/REP-08-0538. PMID 19359354.
  11. ^ Rabinovitch M (decembar 2012). "Molecular pathogenesis of pulmonary arterial hypertension". J. Clin. Invest. 122 (12): 4306–13. doi:10.1172/JCI60658. PMC 3533531. PMID 23202738.
  12. ^ a b c Rabinovitch, Marlene. "Rescuing the BMPR2 Pathway: How and Where Can We Intervene?". Pulmonary Hypertension Association. Arhivirano s originala, 29. 1. 2015. Pristupljeno 29. 1. 2015.
  13. ^ Grünig E, Weissmann S, Ehlken N, Fijalkowska A, Fischer C, Fourme T, Galié N, Ghofrani A, Harrison RE, Huez S, Humbert M, Janssen B, Kober J, Koehler R, Machado RD, Mereles D, Naeije R, Olschewski H, Provencher S, Reichenberger F, Retailleau K, Rocchi G, Simonneau G, Torbicki A, Trembath R, Seeger W (2009). "Stress Doppler echocardiography in relatives of patients with idiopathic and familial pulmonary arterial hypertension: results of a multicenter European analysis of pulmonary artery pressure response to exercise and hypoxia". Circulation. 119 (13): 1747–57. doi:10.1161/CIRCULATIONAHA.108.800938. PMID 19307479.

Vanjski linkovi

Šablon:Signalizacija TGF-beta

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.