XPA

XPA
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1D4U, 1XPA, 2JNW

Identifikatori
AliasiXPA
Vanjski ID-jeviOMIM: 611153 MGI: 99135 HomoloGene: 37298 GeneCards: XPA
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[1]
Hromosom 4 (miš)
Genomska lokacija za XPA
Genomska lokacija za XPA
Bend4 B1|4 24.49 cMPočetak46,155,347 bp[1]
Kraj46,196,311 bp[1]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija vezivanje iona metala
protein domain specific binding
protein homodimerization activity
vezivanje sa DNK
GO:0001948, GO:0016582 vezivanje za proteine
oštećeno vezivanje sa DNK
Ćelijska komponenta intercellular bridge
Replikacijski protein A
nucleotide-excision repair factor 1 complex
jedro
nukleoplazma
citoplazma
Biološki proces nucleotide-excision repair, DNA incision
intrinsic apoptotic signaling pathway in response to DNA damage
transcription-coupled nucleotide-excision repair
GO:0001306 response to oxidative stress
cellular response to DNA damage stimulus
response to auditory stimulus
multicellular organism growth
global genome nucleotide-excision repair
response to toxic substance
response to UV
nucleotide-excision repair, preincision complex assembly
Popravak ekscizijom nukleotida
nucleotide-excision repair, DNA incision, 5'-to lesion
nucleotide-excision repair involved in interstrand cross-link repair
UV-damage excision repair
base-excision repair
nucleotide-excision repair, preincision complex stabilization
nucleotide-excision repair, DNA damage recognition
GO:0100026 Popravka DNK
UV protection
protein localization to nucleus
regulation of autophagy
nucleotide-excision repair, DNA duplex unwinding
nucleotide-excision repair, DNA incision, 3'-to lesion
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000380

NM_011728

RefSeq (bjelančevina)

NP_000371
NP_001341904

NP_035858

Lokacija (UCSC)n/aChr 4: 46.16 – 46.2 Mb
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein za popravku DNK koji nadopunjuje ćelije XP-A je protein koji je kod ljudi kodiran genom XPA , sa hromosoma 9.[4]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 273 aminokiseline, а molekulska masa — 31.368 Da.[4]

1020304050
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSA
TAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEF
DYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLL
KDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEAL
EEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEE
NLEDDMYRKTCTMCGHELTYEKM

Funkcija

Nukleotidni ekscizijski popravak (NER) je glavni put za popravak raznih glomaznih oštećenja DNK, uključujući i ona unesena UV zračenjem. Čini se da XPA protein ima ključnu ulogu u NER-u na mjestima oštećenja kao skela za druge proteine za popravak kako bi se osiguralo da su oštećenja na odgovarajući način izrezana.[5] Među proteinima za popravak s kojima XPA stupa u interakciju je proteinski kompleks (uključujući ERCC1 protein) koji je sposoban urezati DNK na mjestima oštećenja.[6]

Xpa mutantne osobe često pokazuju teške kliničke simptome xeroderma pigmentosum, stanja koje uključuje ekstremnu osjetljivost na sunčevu svjetlost i visoku učestalost raka kože.

Interakcije

Pokazano je da XPA ima interakcije sa ERCC1,[6][7] replikacijskim proteinom A1[8] i XAB2.[9]

Reference

  1. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028329 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ a b "Entrez Gene: XPA xeroderma pigmentosum, complementation group A".
  5. ^ Sugitani N, Sivley RM, Perry KE, Capra JA, Chazin WJ (2016). "XPA: A key scaffold for human nucleotide excision repair". DNA Repair (Amst.). 44: 123–35. doi:10.1016/j.dnarep.2016.05.018. PMC 4958585. PMID 27247238.
  6. ^ a b Li L, Elledge SJ, Peterson CA, Bales ES, Legerski RJ (maj 1994). "Specific association between the human DNA repair proteins XPA and ERCC1". Proceedings of the National Academy of Sciences of the United States of America. 91 (11): 5012–6. Bibcode:1994PNAS...91.5012L. doi:10.1073/pnas.91.11.5012. PMC 43920. PMID 8197174.
  7. ^ Nagai A, Saijo M, Kuraoka I, Matsuda T, Kodo N, Nakatsu Y, Mimaki T, Mino M, Biggerstaff M, Wood RD (Jun 1995). "Enhancement of damage-specific DNA binding of XPA by interaction with the ERCC1 DNA repair protein". Biochemical and Biophysical Research Communications. 211 (3): 960–6. doi:10.1006/bbrc.1995.1905. hdl:1765/60251. PMID 7598728.
  8. ^ Li L, Lu X, Peterson CA, Legerski RJ (Oct 1995). "An interaction between the DNA repair factor XPA and replication protein A appears essential for nucleotide excision repair". Molecular and Cellular Biology. 15 (10): 5396–402. doi:10.1128/mcb.15.10.5396. PMC 230789. PMID 7565690.
  9. ^ Nakatsu Y, Asahina H, Citterio E, Rademakers S, Vermeulen W, Kamiuchi S, Yeo JP, Khaw MC, Saijo M, Kodo N, Matsuda T, Hoeijmakers JH, Tanaka K (Nov 2000). "XAB2, a novel tetratricopeptide repeat protein involved in transcription-coupled DNA repair and transcription". The Journal of Biological Chemistry. 275 (45): 34931–7. doi:10.1074/jbc.M004936200. PMID 10944529.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.