WFS1

WFS1
Identifikatori
AliasiWFS1
Vanjski ID-jeviOMIM: 606201 MGI: 1328355 HomoloGene: 4380 GeneCards: WFS1
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za WFS1
Genomska lokacija za WFS1
Bend4p16.1Početak6,269,849 bp[1]
Kraj6,303,265 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za WFS1
Genomska lokacija za WFS1
Bend5|5 B3Početak37,123,448 bp[2]
Kraj37,146,549 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija ATPase binding
GO:0001948, GO:0016582 vezivanje za proteine
ubiquitin protein ligase binding
calcium-dependent protein binding
calmodulin binding
proteasome binding
Ćelijska komponenta integral component of membrane
endoplasmic reticulum membrane
membrana
integral component of endoplasmic reticulum membrane
dendrit
Endoplazmatski retikulum
Proteasom
endoplasmic reticulum lumen
integral component of synaptic vesicle membrane
Biološki proces GO:1904089 negative regulation of neuron apoptotic process
negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
calcium ion homeostasis
glucose homeostasis
Nefrogeneza
protein stabilization
nervous system process
positive regulation of growth
GO:1901227 negative regulation of transcription by RNA polymerase II
sluh
endoplasmic reticulum calcium ion homeostasis
protein maturation by protein folding
negative regulation of ATF6-mediated unfolded protein response
negative regulation of DNA-binding transcription factor activity
response to endoplasmic reticulum stress
ER overload response
IRE1-mediated unfolded protein response
ubiquitin-dependent ERAD pathway
renal water homeostasis
negative regulation of programmed cell death
positive regulation of protein ubiquitination
negative regulation of type B pancreatic cell apoptotic process
vid
positive regulation of calcium ion transport
pancreas development
endoplasmic reticulum unfolded protein response
olfactory behavior
Posttranslacione modifikacije
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_006005
NM_001145853

NM_011716

RefSeq (bjelančevina)

NP_001139325
NP_005996

NP_035846

Lokacija (UCSC)Chr 4: 6.27 – 6.3 MbChr 5: 37.12 – 37.15 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Volframin jest protein koji je kod ljudi kodiran genom WFS1 sa hromosoma 4.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 890 aminokiselina, а molekulska težina 100.292 Da.[8]

1020304050
MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGP
GPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERAKAGDP
KAQTEVGKHYLQLAGDTDEELNSCTAVDWLVLAAKQGRREAVKLLRRCLA
DRRGITSENEREVRQLSSETDLERAVRKAALVMYWKLNPKKKKQVAVAEL
LENVGQVNEHDGGAQPGPVPKSLQKQRRMLERLVSSESKNYIALDDFVEI
TKKYAKGVIPSSLFLQDDEDDDELAGKSPEDLPLRLKVVKYPLHAIMEIK
EYLIDMASRAGMHWLSTIIPTHHINALIFFFIVSNLTIDFFAFFIPLVIF
YLSFISMVICTLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWN
HLEPYAHFLLSVFFVIFSFPIASKDCIPCSELAVITGFFTVTSYLSLSTH
AEPYTRRALATEVTAGLLSLLPSMPLNWPYLKVLGQTFITVPVGHLVVLN
VSVPCLLYVYLLYLFFRMAQLRNFKGTYCYLVPYLVCFMWCELSVVILLE
STGLGLLRASIGYFLFLFALPILVAGLALVGVLQFARWFTSLELTKIAVT
VAVCSVPLLLRWWTKASFSVVGMVKSLTRSSMVKLILVWLTAIVLFCWFY
VYRSEGMKVYNSTLTWQQYGALCGPRAWKETNMARTQILCSHLEGHRVTW
TGRFKYVRVTDIDNSAESAINMLPFFIGDWMRCLYGEAYPACSPGNTSTA
EEELCRLKLLAKHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTK
DIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNC
MAQLSPTRRHVKIEHDWRSTVHGAVKFAFDFFFFPFLSAA

Funkcija

Ovaj gen kodira transmembranski protein, koji se primarno nalazi u endoplazmatskom retikulumu i sveprisutno eksprimiran sa najvišim nivoima u mozgu, pankreasu, srcu i insulinskim linijama beta-ćelija.[7] Čini se da Wolframin funkcionira kao kationski selektivni ionski kanal.[9]

Klinički značaj

Mutacije u ovom genu povezane su sa Wolframovim sindromom, koji se također naziva DIDMOAD (Diabetes Insipidus, Diabetes Mellitus, optička atrofija i deafness = gluhoća), autosomno recesivnim poremećajem. Bolest karakterizira neimunski insulinski zavisni dijabetes melitus i bilateralna progresivna optička atrofija, koja se obično javlja u djetinjstvu ili ranoj odrasloj dobi. Različiti neurološki simptomi, uključujući predispoziciju za psihijatrijsku bolest, također mogu biti povezani s ovim poremećajem. Veliki broj i raznovrsnost mutacija u ovom genu, posebno u egzonu 8, može biti povezana sa ovim sindromom. Mutacije u ovom genu također mogu uzrokovati autosomno dominantnu gluhoću 6 (DFNA6), također poznatu kao DFNA14 ili DFNA38.[7]

Mutacije ovog gena su takođe povezane sa kongenitalnim kataraktom.[10]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000109501 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000039474 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Polymeropoulos MH, Swift RG, Swift M (Jan 1995). "Linkage of the gene for Wolfram syndrome to markers on the short arm of chromosome 4". Nat Genet. 8 (1): 95–7. doi:10.1038/ng0994-95. PMID 7987399. S2CID 13210147.
  6. ^ Inoue H, Tanizawa Y, Wasson J, Behn P, Kalidas K, Bernal-Mizrachi E, Mueckler M, Marshall H, Donis-Keller H, Crock P, Rogers D, Mikuni M, Kumashiro H, Higashi K, Sobue G, Oka Y, Permutt MA (Oct 1998). "A gene encoding a transmembrane protein is mutated in patients with diabetes mellitus and optic atrophy (Wolfram syndrome)". Nat Genet. 20 (2): 143–8. doi:10.1038/2441. PMID 9771706. S2CID 11917210.
  7. ^ a b c "WFS1 wolframin ER transmembrane glycoprotein [ Homo sapiens (human) ]". National Center for Biotechnology Information.
  8. ^ "UniProt, O76024" (jezik: engleski). Pristupljeno 26. 10. 2021.
  9. ^ Osman AA, Saito M, Makepeace C, Permutt MA, Schlesinger P, Mueckler M (decembar 2003). "Wolframin expression induces novel ion channel activity in endoplasmic reticulum membranes and increases intracellular calcium". J. Biol. Chem. 278 (52): 52755–62. doi:10.1074/jbc.M310331200. PMID 14527944.
  10. ^ Berry V, Gregory-Evans C, Emmett W, Waseem N, Raby J, Prescott D, Moore AT, Bhattacharya SS (mart 2013). "Wolfram gene (WFS1) mutation causes autosomal dominant congenital nuclear cataract in humans". Eur. J. Hum. Genet. 21 (12): 1356–60. doi:10.1038/ejhg.2013.52. PMC 3831071. PMID 23531866.

Dopunska literatura

Vanjski linkovi

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.

}

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.