UTF1

UTF1
Identifikatori
AliasiUTF1
Vanjski ID-jeviOMIM: 604130 MGI: 1276125 HomoloGene: 48226 GeneCards: UTF1
Lokacija gena (čovjek)
Hromosom 10 (čovjek)
Hrom.Hromosom 10 (čovjek)[1]
Hromosom 10 (čovjek)
Genomska lokacija za UTF1
Genomska lokacija za UTF1
Bend10q26.3Početak133,230,217 bp[1]
Kraj133,231,558 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za UTF1
Genomska lokacija za UTF1
Bend7|7 F4Početak139,523,702 bp[2]
Kraj139,525,025 bp[2]
Ontologija gena
Molekularna funkcija• GO:0001105 transcription coactivator activity
• HMG box domain binding
• GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta• jedro
Biološki proces• GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
• male gonad development
• GO:0009373 regulation of transcription, DNA-templated
• transcription, DNA-templated
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez

8433

22286

Ensembl

ENSG00000171794

ENSMUSG00000047751

UniProt

Q5T230

Q6J1H4

RefSeq (mRNK)

NM_003577

NM_009482

RefSeq (bjelančevina)

NP_003568

NP_033508

Lokacija (UCSC)Chr 10: 133.23 – 133.23 MbChr 7: 139.52 – 139.53 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Transkripcijski faktor 1 nediferenciranih embrionskih ćelija je protein koji je kod ljudi kodiran genom UTF1.[5] UTF1, prvi put prijavljen 1998., eksprimira se u pluripotentnim ćelijama uključujući embrionske matične ćelije i ćelije embrionskog karcinoma.[6] Nakon diferencijacije, njegova ekspresija brzo se smanjuje. UTF1 protein je lokaliziran u ćelijskom jedru , gdje funkcionira za regulaciju pluripotentnog stanja hromatina i pufera iRNK, promoviranjem razgradnje iRNK.[7]

Aberantna ekspresija UTF1 zabilježena je i u ćelijama raka grlića maternice, gdje UTF1 genski promotor gubi metilaciju i postaje abnormalno eksprimiran u usporedbi s normalnim ćelijama vrata maternice.[8]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 341 aminokiselina, а molekulska težina 36.439 Da.[9]

1020304050
MLLRPRRPPPLAPPAPPSPASPDPEPRTPGDAPGTPPRRPASPSALGELG
LPVSPGSAQRTPWSARETELLLGTLLQPAVWRALLLDRRQALPTYRRVSA
ALAQQQVRRTPAQCRRRYKFLKDKFREAHGQPPGPFDEQIRKLMGLLGDN
GRKRPRRRSPGSGRPQRARRPVPNAHAPAPSEPDATPLPTARDRDADPTW
TLRFSPSPPKSADASPAPGSPPAPAPTALATCIPEDRAPVRGPGSPPPPP
AREDPDSPPGRPEDCAPPPAAPPSLNTALLQTLGHLGDIANILGPLRDQL
LTLNQHVEQLRGAFDQTVSLAVGFILGSAAAERGVLRDPCQ
C: Cistein
D: Asparaginska kiselina
E: Glutaminska kiselina
F: Fenilalanin
G: Glicin
H: Histidin
I: Izoleucin
K: Lizin
L: Leucin
M: Metionin
N: Asparagin
P: Prolin
Q: Glutamin
R: Arginin
S: Serin
T: Treonin
V: Valin
W: Triptofan
Y: Tirozin

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000171794 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000047751 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Undifferentiated embryonic cell transcription factor 1". Pristupljeno 30. 5. 2013.
  6. ^ Okuda A; Fukushima A; Nishimoto M; Orimo A; Yamagishi T; Nabeshima Y; Kuro-o M; Nabeshima Yi; Boon K; Keaveney M; Stunnenberg HG; Muramatsu M. (april 1998). "UTF1, a novel transcriptional coactivator expressed in pluripotent embryonic stem cells and extra-embryonic cells". EMBO J. 17 (7): 2019–32. doi:10.1093/emboj/17.7.2019. PMC 1170547. PMID 9524124.
  7. ^ Jia J, Zheng X, Hu G, Cui K, Zhang J, Zhang A, Jiang H, Lu B, Yates J, Liu C, Zhao K, Zheng Y (oktobar 2012). "Regulation of pluripotency and self- renewal of ESCs through epigenetic-threshold modulation and mRNA pruning". Cell. 151 (3): 576–89. doi:10.1016/j.cell.2012.09.023. PMC 3575637. PMID 23101626.
  8. ^ Guenin S, Mouallif M, Deplus R, Lampe X, Krusy N, Calonne E, Delbecque K, Kridelka F, Fuks F, Ennaji MM, Delvenne P (august 2012). "Aberrant promoter methylation and expression of UTF1 during cervical carcinogenesis". PLOS ONE. 7 (8): e42704. doi:10.1371/journal.pone.0042704. PMC 3411846. PMID 22880087.
  9. ^ "UniProt, Q5T230". Pristupljeno 2. 9. 2021.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.