UPK2

UPK2
Identifikatori
AliasiUPK2
Vanjski ID-jeviOMIM: 611558 MGI: 98913 HomoloGene: 4920 GeneCards: UPK2
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za UPK2
Genomska lokacija za UPK2
Bend11q23.3Početak118,925,164 bp[1]
Kraj118,958,559 bp[1]
Lokacija gena (miš)
Hromosom 9 (miš)
Hrom.Hromosom 9 (miš)[2]
Hromosom 9 (miš)
Genomska lokacija za UPK2
Genomska lokacija za UPK2
Bend9 A5.2|9 24.84 cMPočetak44,364,012 bp[2]
Kraj44,366,273 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta integral component of membrane
ćelijska membrana
integral component of plasma membrane
Egzosom
apical plasma membrane
membrana
Biološki proces multicellular organism development
epithelial cell differentiation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_006760

NM_009476

RefSeq (bjelančevina)

NP_006751

NP_033502

Lokacija (UCSC)Chr 11: 118.93 – 118.96 MbChr 9: 44.36 – 44.37 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Uroplakin-2 je protein koji je kod ljudi kodiran gengom UPK2.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 184 aminokiselina, а molekulska težina 19.438 Da.[8].

1020304050
MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPP
CHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVSVVDSGAGFTVTR
LSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPRRNMESIGLGM
ARTGGMVVITVLLSVAMFLLVLGFIIALALGSRK

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000110375 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000041523 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Wu RL, Osman I, Wu XR, Lu ML, Zhang ZF, Liang FX, Hamza R, Scher H, Cordon-Cardo C, Sun TT (1998). "Uroplakin II gene is expressed in transitional cell carcinoma but not in bilharzial bladder squamous cell carcinoma: alternative pathways of bladder epithelial differentiation and tumor formation". Cancer Res. 58 (6): 1291–7. PMID 9515818.
  6. ^ Lobban ED, Smith BA, Hall GD, Harnden P, Roberts P, Selby PJ, Trejdosiewicz LK, Southgate J (Dec 1998). "Uroplakin gene expression by normal and neoplastic human urothelium". Am J Pathol. 153 (6): 1957–67. doi:10.1016/S0002-9440(10)65709-4. PMC 1866332. PMID 9846985.
  7. ^ "Entrez Gene: UPK2 uroplakin 2".
  8. ^ "UniProt, O00526". Pristupljeno 28. 8. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.