TSEN54

TSEN54
Identifikatori
AliasiTSEN54
Vanjski ID-jeviOMIM: 608755 MGI: 1923515 HomoloGene: 35476 GeneCards: TSEN54
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za TSEN54
Genomska lokacija za TSEN54
Bend17q25.1Početak75,515,944 bp[1]
Kraj75,524,735 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za TSEN54
Genomska lokacija za TSEN54
Bend11|11 E2Početak115,705,550 bp[2]
Kraj115,713,920 bp[2]
Ontologija gena
Molekularna funkcija tRNA-intron endonuclease activity
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta Jedarce
jedro
tRNA-intron endonuclease complex
nukleoplazma
Biološki proces mRNA processing
tRNA-type intron splice site recognition and cleavage
RNA phosphodiester bond hydrolysis, endonucleolytic
tRNA splicing, via endonucleolytic cleavage and ligation
RNA phosphodiester bond hydrolysis
tRNA processing
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_207346

NM_029557

RefSeq (bjelančevina)

NP_997229

NP_083833

Lokacija (UCSC)Chr 17: 75.52 – 75.52 MbChr 11: 115.71 – 115.71 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica 54 preradne endonuklaze tRNK je proteinska podjedinica koju kod ljudi kodira gen TSEN54.[5]

Dužina polipeptidnog lanca je 526 aminokiselina, a molekulska težina 58.819.[6].

Aminokiselinska sekvenca

Simboli
1020304050
MEPEPEPAAVEVPAGRVLSARELFAARSRSQKLPQRSHGPKDFLPDGSAA
QAERLRRCREELWQLLAEQRVERLGSLVAAEWRPEEGFVELKSPAGKFWQ
TMGFSEQGRQRLHPEEALYLLECGSIHLFHQDLPLSIQEAYQLLLTDHTV
TFLQYQVFSHLKRLGYVVRRFQPSSVLSPYERQLNLDASVQHLEDGDGKR
KRSSSSPRSINKKAKALDNSLQPKSLAASSPPPCSQPSQCPEEKPQESSP
MKGPGGPFQLLGSLGPSPGPAREGVGCSWESGRAENGVTGAGKRRWNFEQ
ISFPNMASDSRHTLLRAPAPELLPANVAGRETDAESWCQKLNQRKEKLSR
REREHHAEAAQFQEDVNADPEVQRCSSWREYKELLQRRQVQRSQRRAPHL
WGQPVTPLLSPGQASSPAVVLQHISVLQTTHLPDGGARLLEKSGGLEIIF
DVYQADAVATFRKNNPGKPYARMCISGFDEPVPDLCSLKRLSYQSGDVPL
IFALVDHGDISFYSFRDFTLPQDVGH

Funkcija

Ovaj gen kodira podjedinicu kompleksa tRNK koji prerađuje endonukleaze, za katalizu uklanjanja introna iz prekursorne tRNK. Kompleks je također uključen u prajmere za obradu pre-iRNK 3-.

Klinički značaj

Mutacije u ovom genu rezultiraju pontocerebelumskom hipoplazijom tipa 2. Sepahvand et al. saopćili su da zbog jako preklapajućih fenotipova sa dobro opisanim tipovima PCH, npr. PCH2, PCH4 i PCH5, treba koristiti pojam "TSENopatije", koji obuhvata sve opisane fenotipove PCH.[7] Također su izvijestili da je pokraj Galenove vene otkriven infratentorijski hronični subdurni hematom koji je razvijen u liniji prednjeg plana, supra– i infratentoriska atrofija, te hipoplazija ponsa, malog i zadnjeg mozga, odgođena cerebelumska mijelinizacija i gubitak volumena i sive i bijele mase, odsutnost presavijanja olivskog jezgra i gubitak poprečnih vlakana ponsa. Ekstraksijalni prostor likvora bio je evidentan i zbog atrofije mozga. O dva nova fenotipa također su izvijestili Sepahvand et al. kao strukturne bolesti srca, uključujući veliki otvoreni foramen ovale (> 23 mikro mjehurića), kanal ductus arteriosus i blagu regurgaciju trokvržičnog i mitralnog zaliska, te bilateralno umjereni senzorinervni gubitak sluha.[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000182173 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000020781 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: TRNA splicing endonuclease subunit 54". Pristupljeno 18. 10. 2016.
  6. ^ "UniProt, Q7Z6J9". Pristupljeno June 14, 2021.
  7. ^ a b Sepahvand A, Razmara E, Bitarafan F, Galehdari M, Tavasoli AR, Almadani N, Garshasbi M (juli 2020). "A homozygote variant in the tRNA splicing endonuclease subunit 54 causes pontocerebellar hypoplasia in a consanguineous Iranian family". EMolecular Genetics and Genomic Medicine. 8 (10): e1413. doi:10.1002/mgg3.1413. PMC 7549571. PMID 32697043.

Dopunska literatura

  • Budde BS, Namavar Y, Barth PG, Poll-The BT, Nürnberg G, Becker C, van Ruissen F, Weterman MA, Fluiter K, te Beek ET, Aronica E, van der Knaap MS, Höhne W, Toliat MR, Crow YJ, Steinling M, Voit T, Roelenso F, Brussel W, Brockmann K, Kyllerman M, Boltshauser E, Hammersen G, Willemsen M, Basel-Vanagaite L, Krägeloh-Mann I, de Vries LS, Sztriha L, Muntoni F, Ferrie CD, Battini R, Hennekam RC, Grillo E, Beemer FA, Stoets LM, Wollnik B, Nürnberg P, Baas F (2008). "tRNA splicing endonuclease mutations cause pontocerebellar hypoplasia". Nat. Genet. 40 (9): 1113–8. doi:10.1038/ng.204. PMID 18711368. S2CID 205345070.
  • Cassandrini D, Biancheri R, Tessa A, Di Rocco M, Di Capua M, Bruno C, Denora PS, Sartori S, Rossi A, Nozza P, Emma F, Mezzano P, Politi MR, Laverda AM, Zara F, Pavone L, Simonati A, Leuzzi V, Santorelli FM, Bertini E (2010). "Pontocerebellar hypoplasia: clinical, pathologic, and genetic studies". Neurology. 75 (16): 1459–64. doi:10.1212/WNL.0b013e3181f88173. PMID 20956791. S2CID 13619763.
  • Maricich SM, Aqeeb KA, Moayedi Y, Mathes EL, Patel MS, Chitayat D, Lyon G, Leroy JG, Zoghbi HY (2011). "Pontocerebellar hypoplasia: review of classification and genetics, and exclusion of several genes known to be important for cerebellar development". J. Child Neurol. 26 (3): 288–94. doi:10.1177/0883073810380047. PMID 21383226. S2CID 27332548.
  • Simonati A, Cassandrini D, Bazan D, Santorelli FM (2011). "TSEN54 mutation in a child with pontocerebellar hypoplasia type 1". Acta Neuropathol. 121 (5): 671–3. doi:10.1007/s00401-011-0823-1. PMID 21468723. S2CID 30764162.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.