TRAM2

TRAM2
Identifikatori
AliasiTRAM2
Vanjski ID-jeviOMIM: 608485 MGI: 1924817 HomoloGene: 8183 GeneCards: TRAM2
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za TRAM2
Genomska lokacija za TRAM2
Bend6p12.2Početak52,497,408 bp[1]
Kraj52,577,060 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za TRAM2
Genomska lokacija za TRAM2
Bend1|1 A4Početak21,066,523 bp[2]
Kraj21,149,453 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta membrana
integral component of membrane
rough endoplasmic reticulum
Biološki proces protein transport
collagen biosynthetic process
protein insertion into ER membrane
SRP-dependent cotranslational protein targeting to membrane, translocation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_012288

NM_177409

RefSeq (bjelančevina)

NP_036420

NP_803128

Lokacija (UCSC)Chr 6: 52.5 – 52.58 MbChr 1: 21.07 – 21.15 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Membranski protein 2 na translokacijskom lancu jest protein koji je kod ljudi kodiran genom TRAM2.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 370 aminokiselina, а molekulska težina 43.328 Da.[8]

1020304050
MAFRRRTKSYPLFSQEFVIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFI
LPQYNISVPTADSETVHYHYGPKDLVTILFYIFITIILHAVVQEYILDKI
SKRLHLSKVKHSKFNESGQLVVFHFTSVIWCFYVVVTEGYLTNPRSLWED
YPHVHLPFQVKFFYLCQLAYWLHALPELYFQKVRKEEIPRQLQYICLYLV
HIAGAYLLNLSRLGLILLLLQYSTEFLFHTARLFYFADENNEKLFSAWAA
VFGVTRLFILTLAVLAIGFGLARMENQAFDPEKGNFNTLFCRLCVLLLVC
AAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHE
NGVVKAENGTSPRTKKLKSP

Funkcija

TRAM2 je komponenta translokona, zatvorenog makromolekulskog kanala koji kontrolira posttranslacijsku obradu nastajućih sekretornih i membranskih proteina na membrani endoplazmatskog retikuluma (ER).[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000065308 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000041779 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Nomura N, Nagase T, Miyajima N, Sazuka T, Tanaka A, Sato S, Seki N, Kawarabayasi Y, Ishikawa K, Tabata S (Dec 1995). "Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1". DNA Res. 1 (5): 223–9. doi:10.1093/dnares/1.5.223. PMID 7584044.
  6. ^ Onuchic LF, Mrug M, Lakings AL, Muecher G, Becker J, Zerres K, Avner ED, Dixit M, Somlo S, Germino GG, Guay-Woodford LM (Jan 2000). "Genomic organization of the KIAA0057 gene that encodes a TRAM-like protein and its exclusion as a polycystic kidney and hepatic disease 1 (PKHD1) candidate gene". Mamm Genome. 10 (12): 1175–8. doi:10.1007/s003359901186. PMID 10594243. S2CID 11705244.
  7. ^ a b "Entrez Gene: TRAM2 translocation associated membrane protein 2".
  8. ^ "UniProt, Q15035" (jezik: engleski). Pristupljeno 5. 10. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.