TPT1

TPT1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1YZ1, 3EBM, 4Z9V, 2HR9

Identifikatori
AliasiTPT1-AS1
Vanjski ID-jeviOMIM: 600763 MGI: 104890 HomoloGene: 55730 GeneCards: TPT1-AS1
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[1]
Hromosom 14 (miš)
Genomska lokacija za TPT1
Genomska lokacija za TPT1
Bend14 D3|14 40.29 cMPočetak76,082,533 bp[1]
Kraj76,085,965 bp[1]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija calcium ion binding
GO:0001948, GO:0016582 vezivanje za proteine
microtubule binding
vezivanje sa RNK
Ćelijska komponenta citoplazma
multivesicular body
tubulin complex
Egzosom
jedro
Vanćelijsko
citosol
spindle pole
cytoplasmic microtubule
Biološki proces regulation of apoptotic process
response to virus
cellular calcium ion homeostasis
negative regulation of apoptotic process
negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
calcium ion transport
Ćelijska diferencijacija
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

n/a

NM_009429

RefSeq (bjelančevina)

NP_001273201
NP_001273202
NP_003286

NP_033455

Lokacija (UCSC)n/aChr 14: 76.08 – 76.09 Mb
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Translacijski kontrolirani tumorski protein ili TCPT (eng. Translationally Controlled Tumor Protein: TCTP) je protein koji je kod ljudi kodiran genom TPT1.[4][5][6] TCTP protein se također naziva i Q23.[7] P21,[8] P23,[9] histamin-otpuštajući faktor (HRF),[10] i fortilin.[11] TCTP je multifunkcijski i visoko konzervirani protein koji je sveprisutan u različitim vrstama eukariota i široko rasprostranjen u različitim tkivima i tipovima ćelija.[12]

Mapiran je na hromosomu 13, sekvencaq12-q1413.[5] Ljudski gen sadrži pet introna i šest egzona i promotor, sa kanonskim TATA-kutijom i nekoliko promotorskih elemenata, koji su kod sisaradobro konzervirani.[13] Test sa reporter genom pokazuje snažnu promotorsku aktivnost, uporedivu sa virusnim promotorima.[14]

Ljudski translacijski kontrolirani tumorski protein (hTCTP) je protein povezan s rastom, koji veže kalcij.[15]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 172 aminokiseline, a molekulska težina 19 595 Da.[16]

1020304050
MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGG
NASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIK
GKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLD
YREDGVTPYMIFFKDGLEMEKC
Simboli

Struktura

Poravnavanje sekvenci TCTP iz više od 30 različitih vrsta otkriva visok stepen konzerviranosti tokom dugog perioda evolucije.

Struktura rastvora TCTP iz kvasca, Schizosaccharomyces pombe utvrđena je NMR-spektroskopijom koja je pokazala da je ovaj protein strukturno sličan s dva mala šaperona bez guaninskih nukleotida, Mss4 i Dss4.[17] TCTP and Mss4/Dss4 are now therefore structurally grouped into one protein superfamily.[13]

Translacijski kontrolirani tumorski protein (TCTP) uključen je u širok raspon molekulskih interakcija s biološkim i nebiološkim partnerima različitih hemijskih sastava kao što su proteini, peptidi, nukleinske kiseline, ugljikohidrati ili male molekule. TCTP je stoga važna i svestrana platforma za povezivanje. Mnoge od ovih interakcija protein-protein su potvrđene, iako je samo nekolicina dobila dubinsku strukturnu karakterizaciju. U TCTP/tpt1-remodelirajućim signalnim matičnim ćelijama do bolesti, fokus je na strukturnoj analizi TCTP -a i pregledu dostupne literature o njegovoj interakcijskoj mreži iz strukturne perspektive.[18]

Obilježja

TCTP je protein od 20-25 kDa koji se obilno i sveprisutno eksprimira u ćeliji. Transkribira se u više od 500 različitih tkiva i tipova ćelija; Ljudski (hTCTP) gen jedan je od 10 najpoznatijih i najčešće prisutnih gena kod ljudi, ispitivanjem biblioteke od 1.753 različitih tkiva,[19] but differed considerably in their quantity and ratio of expression. The expression is lower in kidney and renal cells.[20] This indicates an extensive transcriptional control and involvement of tissue-specific factors.[13]

Većina publikacija je utvrdila da je TCTP citoplazmatski protein, ali je prijavljena i jedarna lokalizacija, kao i vanćelijska aktivnost; međutim, proces sekrecije nije pronađen.[13]

Funkcija

Obilje i sveprisutnost ukazuju na to da TCTP može imati važne primarne funkcije. Međutim, veliki broj ćelijskih i biohemijskih funkcija otkriven je od 1980-ih. Većina ovih funkcija može se klasificirati u tri grupe.[15]

Povezano sa rastom

TCTP ima svojstva proteina koji veže tubulin, a ovaj se povezuje s mikrotubulama na način ovisan o ćelijskom ciklusu.[21][22]

Prolazna prekomjerna ekspresija TCTP-a u HeLa ćelijama spriječila ih je da prođu apoptozu izazvanu etopozidom. Ekspresija TCTP u U2OS (epitelne ćelije osteosarkoma ljudske kosti) štitila ih je od ćelijske smrti, inducirano etopozidom u različitim koncentracijama i trajanju izloženosti.[11] Prekomjerna ekspresija TCTP-a inhibirala je sličnu aktivnost kaspaze-3, procjenjuje se, cijepanjem fluorogenog supstrata.[11]

Nivoi ekspresije TCTP su sniženi na nivou iRNK i proteina tokom supresije tumora i aktivacijom p53 i Siah-1, vrlo dobro poznatih antitumorskih gena.[23][24] Podregulacija TCTP-a može izazvati reverziju tumora, a u kombinaciji s nekim lijekovima koji smanjuju razinu TCTP-a i dovesti do ubijanja tumorskih ćelija.[25] Destrukcija TCTP-a u primarnim tumorskim ćelijama dojke rezultira povećanom ekspresijom p53 i smanjenim brojem ćelija raka sličnih stabljici.[26]

Smanjenje nivoa TCTP (dTCTP) u Drosophila smanjuje veličinu ćelija, broj ćelija i veličinu organa, što oponaša mutirane fenotipove Drosophila rheb (dRheb ); ljudski TCTP (hTCTP) pokazuje slična biohemijska svojstva u odnosu na dTCTP.

Vezano za imunost

TCTP je uzrokovao oslobađanje histamina iz ljudskih bazofila subpopulacije donora, a to oslobađanje ovisilo je o IgE.[10][27]

Ekspresija TCTP-a regulirana je na dva različita nivoa; iscrpljivanje kalcija u ER uzrokuje povećanje obilja TCTP-a iRNK, a povećane koncentracije citosolnog kalcija reguliraju ekspresiju gena na posttranskripcijskom nivou.[20][28][29]

Podregulacija nivoa proteina pomoću siRNK u HTR-8/SVneo (Homo sapiens ćelije posteljice) bila je povezana sa smanjenom ćelijskom aktivnošću unosa kalcija i puferskog kapaciteta.[13]

Povezano sa kancerom

Translacijski kontrolirani tumorski protein ima ulogu u razvoju i reverziji tumora.[30][31]

Translacijski kontrolirani tumorski protein (TCTP/tpt1) regulator je odjeljka matičnih čelija raka,[32] reverzije tumora,[33][34] tumorske progresije i određenih oblika [[upala|upalnih bolesti.[10] Štaviše, TCTP je opisan kao protein za preživljavanje koji antagonizira BAX funkciju.[35]

Interakcije

Pokazalo se da TCTP ima interakcije sa:

Reference

  1. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000060126 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ Gross B, Gaestel M, Böhm H, Bielka H (oktobar 1989). "cDNA sequence coding for a translationally controlled human tumor protein". Nucleic Acids Research. 17 (20): 8367. doi:10.1093/nar/17.20.8367. PMC 334973. PMID 2813067.
  5. ^ a b MacDonald SM, Paznekas WA, Jabs EW (Jun 1999). "Chromosomal localization of tumor protein, translationally-controlled 1 (TPT1) encoding the human histamine releasing factor (HRF) to 13q12-->q14". Cytogenetics and Cell Genetics. 84 (1–2): 128–9. doi:10.1159/000015238. PMID 10343127. S2CID 38129789.
  6. ^ "Entrez Gene: TPT1 tumor protein, translationally-controlled 1".
  7. ^ Thomas G, Thomas G, Luther H (septembar 1981). "Transcriptional and translational control of cytoplasmic proteins after serum stimulation of quiescent Swiss 3T3 cells". Proceedings of the National Academy of Sciences of the United States of America. 78 (9): 5712–6. Bibcode:1981PNAS...78.5712T. doi:10.1073/pnas.78.9.5712. PMC 348838. PMID 6946510.
  8. ^ Yenofsky R, Bergmann I, Brawerman G (oktobar 1982). "Messenger RNA species partially in a repressed state in mouse sarcoma ascites cells". Proceedings of the National Academy of Sciences of the United States of America. 79 (19): 5876–80. Bibcode:1982PNAS...79.5876Y. doi:10.1073/pnas.79.19.5876. PMC 347013. PMID 6964392.
  9. ^ Böhm H, Benndorf R, Gaestel M, Gross B, Nürnberg P, Kraft R, Otto A, Bielka H (august 1989). "The growth-related protein P23 of the Ehrlich ascites tumor: translational control, cloning and primary structure". Biochemistry International. 19 (2): 277–86. PMID 2479380.
  10. ^ a b c MacDonald SM, Rafnar T, Langdon J, Lichtenstein LM (august 1995). "Molecular identification of an IgE-dependent histamine-releasing factor". Science. 269 (5224): 688–90. Bibcode:1995Sci...269..688M. doi:10.1126/science.7542803. PMID 7542803.
  11. ^ a b c Li F, Zhang D, Fujise K (decembar 2001). "Characterization of fortilin, a novel antiapoptotic protein". The Journal of Biological Chemistry. 276 (50): 47542–9. doi:10.1074/jbc.M108954200. PMID 11598139.
  12. ^ Ren C, Chen T, Jiang X, Wang Y, Hu C (decembar 2014). "The first characterization of gene structure and biological function for echinoderm translationally controlled tumor protein (TCTP)". Fish & Shellfish Immunology. 41 (2): 137–46. doi:10.1016/j.fsi.2014.08.030. PMID 25193395.
  13. ^ a b c d e Bommer UA, Thiele BJ (mart 2004). "The translationally controlled tumour protein (TCTP)". The International Journal of Biochemistry & Cell Biology. 36 (3): 379–85. doi:10.1016/S1357-2725(03)00213-9. PMID 14687915.
  14. ^ Thiele H, Berger M, Lenzner C, Kühn H, Thiele BJ (oktobar 1998). "Structure of the promoter and complete sequence of the gene coding for the rabbit translationally controlled tumor protein (TCTP) P23". European Journal of Biochemistry / FEBS. 257 (1): 62–8. doi:10.1046/j.1432-1327.1998.2570062.x. PMID 9799103.
  15. ^ a b Feng Y, Liu D, Yao H, Wang J (novembar 2007). "Solution structure and mapping of a very weak calcium-binding site of human translationally controlled tumor protein by NMR". Archives of Biochemistry and Biophysics. 467 (1): 48–57. doi:10.1016/j.abb.2007.08.021. PMID 17897616.
  16. ^ "UniProt, P13693". Pristupljeno 5. 8. 2021.
  17. ^ Thaw P, Baxter NJ, Hounslow AM, Price C, Waltho JP, Craven CJ (august 2001). "Structure of TCTP reveals unexpected relationship with guanine nucleotide-free chaperones". Nature Structural Biology. 8 (8): 701–4. doi:10.1038/90415. PMID 11473261. S2CID 6451004.
  18. ^ Telerman A, Amson R (2017). TCTP/tpt1 - Remodeling Signaling from Stem Cell to Disease. Results and Problems in Cell Differentiation. vol 64. str. 9–46. doi:10.1007/978-3-319-67591-6_2. ISBN 978-3-319-67590-9. PMID 29149402. |volume= sadrži dodatni tekst (pomoć)
  19. ^ Thompson HG, Harris JW, Wold BJ, Quake SR, Brody JP (oktobar 2002). "Identification and confirmation of a module of coexpressed genes". Genome Research. 12 (10): 1517–22. doi:10.1101/gr.418402. PMC 187523. PMID 12368243.
  20. ^ a b Greška kod citiranja: Nevaljana oznaka <ref>; nije naveden tekst za reference s imenom "Sanchez_1997"
  21. ^ Gachet Y, Tournier S, Lee M, Lazaris-Karatzas A, Poulton T, Bommer UA (april 1999). "The growth-related, translationally controlled protein P23 has properties of a tubulin binding protein and associates transiently with microtubules during the cell cycle". Journal of Cell Science. 112 (8): 1257–71. PMID 10085260.
  22. ^ Yarm FR (septembar 2002). "Plk phosphorylation regulates the microtubule-stabilizing protein TCTP". Molecular and Cellular Biology. 22 (17): 6209–21. doi:10.1128/MCB.22.17.6209-6221.2002. PMC 134017. PMID 12167714.
  23. ^ Cans C, Passer BJ, Shalak V, Nancy-Portebois V, Crible V, Amzallag N, Allanic D, Tufino R, Argentini M, Moras D, Fiucci G, Goud B, Mirande M, Amson R, Telerman A (novembar 2003). "Translationally controlled tumor protein acts as a guanine nucleotide dissociation inhibitor on the translation elongation factor eEF1A". Proceedings of the National Academy of Sciences of the United States of America. 100 (24): 13892–7. Bibcode:2003PNAS..10013892C. doi:10.1073/pnas.2335950100. PMC 283517. PMID 14623968.
  24. ^ Rinnerthaler M, Jarolim S, Heeren G, Palle E, Perju S, Klinger H, Bogengruber E, Madeo F, Braun RJ, Breitenbach-Koller L, Breitenbach M, Laun P (1. 6. 2016). "MMI1 (YKL056c, TMA19), the yeast orthologue of the translationally controlled tumor protein (TCTP) has apoptotic functions and interacts with both microtubules and mitochondria". Biochimica et Biophysica Acta (BBA) - Bioenergetics. 1757 (5–6): 631–8. doi:10.1016/j.bbabio.2006.05.022. PMID 16806052.
  25. ^ Tuynder M, Fiucci G, Prieur S, Lespagnol A, Géant A, Beaucourt S, Duflaut D, Besse S, Susini L, Cavarelli J, Moras D, Amson R, Telerman A (oktobar 2004). "Translationally controlled tumor protein is a target of tumor reversion". Proceedings of the National Academy of Sciences of the United States of America (jezik: engleski). 101 (43): 15364–9. Bibcode:2004PNAS..10115364T. doi:10.1073/pnas.0406776101. PMC 523462. PMID 15489264.
  26. ^ Amson R, Pece S, Lespagnol A, Vyas R, Mazzarol G, Tosoni D, Colaluca I, Viale G, Rodrigues-Ferreira S, Wynendaele J, Chaloin O, Hoebeke J, Marine JC, Di Fiore PP, Telerman A (januar 2012). "Reciprocal repression between P53 and TCTP". Nature Medicine (jezik: engleski). 18 (1): 91–9. doi:10.1038/nm.2546. PMID 22157679. S2CID 22984419.
  27. ^ Bheekha-Escura R, MacGlashan DW, Langdon JM, MacDonald SM (septembar 2000). "Human recombinant histamine-releasing factor activates human eosinophils and the eosinophilic cell line, AML14-3D10". Blood. 96 (6): 2191–8. doi:10.1182/blood.V96.6.2191. PMID 10979965.
  28. ^ Xu A, Bellamy AR, Taylor JA (septembar 1999). "Expression of translationally controlled tumour protein is regulated by calcium at both the transcriptional and post-transcriptional level". The Biochemical Journal. 342 (3): 683–9. doi:10.1042/0264-6021:3420683. PMC 1220510. PMID 10477280.
  29. ^ Haghighat NG, Ruben L (mart 1992). "Purification of novel calcium binding proteins from Trypanosoma brucei: properties of 22-, 24- and 38-kilodalton proteins". Molecular and Biochemical Parasitology. 51 (1): 99–110. doi:10.1016/0166-6851(92)90205-x. PMID 1565142.
  30. ^ Hsu YC, Chern JJ, Cai Y, Liu M, Choi KW (2007). "Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase". Nature. 445 (7129): 785–8. Bibcode:2007Natur.445..785H. doi:10.1038/nature05528. PMID 17301792. S2CID 4302643.
  31. ^ Tuynder M, Susini L, Prieur S, Besse S, Fiucci G, Amson R, Telerman A (2002). "Biological models and genes of tumor reversion: cellular reprogramming through tpt1/TCTP and SIAH-1". Proceedings of the National Academy of Sciences of the United States of America. 99 (23): 14976–81. Bibcode:2002PNAS...9914976T. doi:10.1073/pnas.222470799. PMC 137530. PMID 12399545.
  32. ^ Amson R, Pece S, Lespagnol A, Vyas R, Mazzarol G, Tosoni D, Colaluca I, Viale G, Rodrigues-Ferreira S, Wynendaele J, Chaloin O, Hoebeke J, Marine JC, Di Fiore PP, Telerman A (decembar 2011). "Reciprocal repression between P53 and TCTP". Nature Medicine. 18 (1): 91–9. doi:10.1038/nm.2546. PMID 22157679. S2CID 22984419.
  33. ^ Tuynder M, Susini L, Prieur S, Besse S, Fiucci G, Amson R, Telerman A (novembar 2002). "Biological models and genes of tumor reversion: cellular reprogramming through tpt1/TCTP and SIAH-1". Proceedings of the National Academy of Sciences of the United States of America. 99 (23): 14976–81. Bibcode:2002PNAS...9914976T. doi:10.1073/pnas.222470799. PMC 137530. PMID 12399545.
  34. ^ Tuynder M, Fiucci G, Prieur S, Lespagnol A, Géant A, Beaucourt S, Duflaut D, Besse S, Susini L, Cavarelli J, Moras D, Amson R, Telerman A (oktobar 2004). "Translationally controlled tumor protein is a target of tumor reversion". Proceedings of the National Academy of Sciences of the United States of America. 101 (43): 15364–9. Bibcode:2004PNAS..10115364T. doi:10.1073/pnas.0406776101. PMC 523462. PMID 15489264.
  35. ^ a b Susini L, Besse S, Duflaut D, Lespagnol A, Beekman C, Fiucci G, Atkinson AR, Busso D, Poussin P, Marine JC, Martinou JC, Cavarelli J, Moras D, Amson R, Telerman A (august 2008). "TCTP protects from apoptotic cell death by antagonizing bax function". Cell Death and Differentiation. 15 (8): 1211–20. doi:10.1038/cdd.2008.18. PMID 18274553.
  36. ^ Liu H, Peng HW, Cheng YS, Yuan HS, Yang-Yen HF (april 2005). "Stabilization and enhancement of the antiapoptotic activity of mcl-1 by TCTP". Molecular and Cellular Biology. 25 (8): 3117–26. doi:10.1128/MCB.25.8.3117-3126.2005. PMC 1069602. PMID 15798198.
  37. ^ Thébault S, Agez M, Chi X, Stojko J, Cura V, Telerman SB, Maillet L, Gautier F, Billas-Massobrio I, Birck C, Troffer-Charlier N, Karafin T, Honoré J, Senff-Ribeiro A, Montessuit S, Johnson CM, Juin P, Cianférani S, Martinou JC, Andrews DW, Amson R, Telerman A, Cavarelli J (januar 2016). "TCTP contains a BH3-like domain, which instead of inhibiting, activates Bcl-xL". Scientific Reports. 6: 19725. Bibcode:2016NatSR...619725T. doi:10.1038/srep19725. PMC 4728560. PMID 26813996.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.