TMEM109

TMEM109
Identifikatori
AliasiTMEM109
Vanjski ID-jeviMGI: 1915789 HomoloGene: 11458 GeneCards: TMEM109
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za TMEM109
Genomska lokacija za TMEM109
Bend11q12.2Početak60,914,158 bp[1]
Kraj60,923,443 bp[1]
Lokacija gena (miš)
Hromosom 19 (miš)
Hrom.Hromosom 19 (miš)[2]
Hromosom 19 (miš)
Genomska lokacija za TMEM109
Genomska lokacija za TMEM109
Bend19|19 APočetak10,848,024 bp[2]
Kraj10,859,365 bp[2]
Ontologija gena
Molekularna funkcija voltage-gated ion channel activity
molekularna funkcija
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta sarcoplasmic reticulum membrane
Egzosom
endoplasmic reticulum membrane
jedro
membrana
Sarkoplazmatski retikulum
nuclear outer membrane
integral component of membrane
Endoplazmatski retikulum
Biološki proces ion transport
negative regulation of cell death
cellular response to gamma radiation
intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
regulation of ion transmembrane transport
GO:0015915 transport
ion transmembrane transport
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_024092

NM_134142

RefSeq (bjelančevina)

NP_076997

NP_598903

Lokacija (UCSC)Chr 11: 60.91 – 60.92 MbChr 19: 10.85 – 10.86 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Transmembranski protein 109 je protein koji je kod ljudi kodiran genom TMEM109. [5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 243 aminokiseline, а molekulska težina 26.210 Da.[6].

1020304050
MAASSISSPWGKHVFKAILMVLVALILLHSALAQSRRDFAPPGQQKREAP
VDVLTQIGRSVRGTLDAWIGPETMHLVSESSSQVLWAISSAISVAFFALS
GIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALVVYWLLSLLLG
LVLALLGRILWGLKLVIFLAGFVALMRSVPDPSTRALLLLALLILYALLS
RLTGSRASGAQLEAKVRGLERQVEELRWRQRRAAKGARSVEEE

Ovaj protein tvori kationski ionski kanal u membrani endoplazmatskog retikuluma, skupljajući šest identičnih podjedinica.[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000110108 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000034659 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Transmembrane protein 109". Pristupljeno 2. 7. 2016.
  6. ^ "UniProt, Q9BVC6". Pristupljeno 28. 8. 2021.
  7. ^ Venturi, Elisa; Mio, Kazuhiro; Nishi, Miyuki; Ogura, Toshihiko; Moriya, Toshio; Pitt, Samantha J.; Okuda, Kazutaka; Kakizawa, Sho; Sitsapesan, Rebecca; Sato, Chikara; Takeshima, Hiroshi (2011). "Mitsugumin 23 Forms a Massive Bowl-Shaped Assembly and Cation-Conducting Channel". Biochemistry. 50 (13): 2623–2632. doi:10.1021/bi1019447. ISSN 0006-2960.

Dopunska literatura

  • Yamazaki T, Sasaki N, Nishi M, Takeshima H (2010). "Facilitation of DNA damage-induced apoptosis by endoplasmic reticulum protein mitsugumin23". Biochem. Biophys. Res. Commun. 392 (2): 196–200. doi:10.1016/j.bbrc.2010.01.013. PMID 20060811.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.