TIP39

TIP39
Identifikatori
AliasiPTH2
Vanjski ID-jeviOMIM: 608386 MGI: 2152297 HomoloGene: 14235 GeneCards: PTH2
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za TIP39
Genomska lokacija za TIP39
Bend19q13.33Početak49,422,419 bp[1]
Kraj49,423,441 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za TIP39
Genomska lokacija za TIP39
Bend7|7 B3Početak44,830,419 bp[2]
Kraj44,831,262 bp[2]
Ortolozi
VrsteČovjekMiš
Entrez

113091

114640

Ensembl

ENSG00000142538

ENSMUSG00000038300

UniProt

Q96A98

Q91W27

RefSeq (mRNK)

NM_178449

NM_053256

RefSeq (bjelančevina)

NP_848544

NP_444486

Lokacija (UCSC)Chr 19: 49.42 – 49.42 MbChr 7: 44.83 – 44.83 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Tuberoinfundibulski peptid od 39 ostataka je protein koji je kod ljudi kodiran genom PTH2.[5][6]

TIP39 povezan je s paratiroidnim hormonom (PTH; MIM 168450) i s proteinima povezanim s PTH (PTHRP; MIM 168470) i ligand je za PTH receptor-2 (PTHR2; MIM 601469), prema OMIM-u.[6]

Molekulska interakcija TIP39 s receptorima PTH2 okarakterizirana je u 3D detaljima, identificirajući među ostalim ostacima Tyr-318 u transmembranskoj spirali 5, kao ključni ostatak za vezanje s visokim afinitetom [7]

Aminokiselinska sekvenca

Simboli

C: Cistein
D: Asparaginska kiselina
E: Glutaminska kiselina
F: Fenilalanin
G: Glicin
H: Histidin
I: Izoleucin
K: Lizin
L: Leucin
M: Metionin
N: Asparagin
P: Prolin
Q: Glutamin
R: Arginin
S: Serin
T: Treonin
V: Valin
W: Triptofan
Y: Tirozin

1020304050
METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRA
WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000142538 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000038300 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ John MR, Arai M, Rubin DA, Jonsson KB, Juppner H (Feb 2002). "Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues". Endocrinology. 143 (3): 1047–57. doi:10.1210/en.143.3.1047. PMID 11861531.
  6. ^ a b "Entrez Gene: TIP39 tuberoinfundibular 39 residue protein precursor".
  7. ^ Weaver RE, Mobarec JC, Wigglesworth MJ, Reynolds CA, Donnelly D (2017). "High affinity binding of the peptide agonist TIP-39 to the Parathyroid hormone 2 (PTH2) receptor requires the hydroxyl group of Tyr-318 on transmembrane helix 5". Biochemical Pharmacology. 127: 71–81. doi:10.1016/j.bcp.2016.12.013. PMC 5303546. PMID 28012961.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.