THOC5

THOC5
Identifikatori
AliasiTHOC5
Vanjski ID-jeviOMIM: 612733 MGI: 1351333 HomoloGene: 37836 GeneCards: THOC5
Lokacija gena (čovjek)
Hromosom 22 (čovjek)
Hrom.Hromosom 22 (čovjek)[1]
Hromosom 22 (čovjek)
Genomska lokacija za THOC5
Genomska lokacija za THOC5
Bend22q12.2Početak29,505,879 bp[1]
Kraj29,555,216 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za THOC5
Genomska lokacija za THOC5
Bend11|11 A1Početak4,845,320 bp[2]
Kraj4,878,867 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
vezivanje sa RNK
mRNA binding
Ćelijska komponenta citoplazma
THO complex
THO complex part of transcription export complex
transcription export complex
jedro
nukleoplazma
nuclear chromosome
Biološki proces positive regulation of DNA-templated transcription, elongation
primitive hemopoiesis
mRNA processing
Ćelijska diferencijacija
mRNA transport
viral mRNA export from host cell nucleus
negative regulation of DNA damage checkpoint
monocyte differentiation
Prerada RNK
RNA export from nucleus
mRNA export from nucleus
mRNA 3'-end processing
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001002877
NM_001002878
NM_001002879
NM_003678

NM_172438

RefSeq (bjelančevina)

NP_001002877
NP_001002878
NP_001002879
NP_003669

NP_766026

Lokacija (UCSC)Chr 22: 29.51 – 29.56 MbChr 11: 4.85 – 4.88 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Homolog podjedinice 5 THO kompleksa jest protein koji je kod ljudi kodiran genom THOC5 sa hromosoma 22. THOCs je član THO kompleksa koji je potkompleks kompleksa za transkripciju/eksport (TREX).

THOC5 je evolucijski konzerviran kod viših eukariota, ali tačne uloge THOC5 u transkripciji i ieksportu iRNK još uvijek nisu jasne. THOC5 je fosforiliziran pomoću nekoliko protein-kinaza na više ostataka nakon vanćelijskog stimulusa. To uključuje stimulaciju faktorima rasta/citokinima/hemokinima ili reagensima za oštećenje DNK. Nadalje, THOC5 je supstrat za nekoliko onkogenih tirozin-kinaza, što sugerira da THOC5 može biti uključen u razvoj raka.

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 683 aminokiseline, a molekulska težina 78.508 Da.

1020304050
MSSESSKKRKPKVIRSDGAPAEGKRNRSDTEQEGKYYSEEAEVDLRDPGR
DYELYKYTCQELQRLMAEIQDLKSRGGKDVAIEIEERRIQSCVHFMTLKK
LNRLAHIRLKKGRDQTHEAKQKVDAYHLQLQNLLYEVMHLQKEITKCLEF
KSKHEEIDLVSLEEFYKEAPPDISKAEVTMGDPHQQTLARLDWELEQRKR
LAEKYRECLSNKEKILKEIEVKKEYLSSLQPRLNSIMQASLPVQEYLFMP
FDQAHKQYETARHLPPPLYVLFVQATAYGQACDKTLSVAIEGSVDEAKAL
FKPPEDSQDDESDSDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVML
DLKCKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSV
LSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGGL
HFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALHKQFASLEHGI
VPVTSDCQYLFPAKVVSRLVKWVTVAHEDYMELHFTKDIVDAGLAGDTNL
YYMALIERGTAKLQAAVVLNPGYSSIPPVFQLCLNWKGEKTNSNDDNIRA
MEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPK
EFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR

Funkcija

Nedavni podaci o THOC5 nokaut-miševima otkrivaju da je THOC5 bitan element u održavanju matičnih ćelija i faktor rasta/citokinom posredovane diferencijacije/ proliferacije. Nadalje, iscrpljivanje THOC5 utiče na manje od 1% ukupnog eksporta iRNK u stabilnom stanju, ali utiče na više od 90% gena indukovanih faktorom rasta/citokinom. THOC5, na taj način doprinosi 3′ obradi i/ili eksportu neposredno ranih gena induciranih vanćelijskim stimulansima. Ove studije donose novi uvid u vezu između kompleksa za eksport iRNK i neposrednog ranog genskog odgovora.

Podaci iz ovih studija takođe sugerišu da THOC5 može biti koristan alat za proučavanje biologije matičnih ćelija, za modifikaciju procesa diferencijacije i za terapiju raka.[5][6][7][8][9][10][11][12][13][14][15][16][17][18][19][20][21][22]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000100296 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000034274 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Tran DDH, Koch A and Tamura T. THOC5, a member of the mRNA export complex: a novel link between mRNA export machinery and signal transduction pathways in cell proliferation and differentiation. Cell Communication and Signaling 2014, 12:3
  6. ^ Tran DD, Saran S, Dittrich-Breiholz O, Williamson AJ, Klebba-Farber S, Koch A, Kracht M, Whetton AD, Tamura T (2013) Transcriptional regulation of immediate-early gene response by THOC5, a member of mRNA export complex, contributes to the M-CSF-induced macrophage differentiation. Cell death & disease 4: e879
  7. ^ Saran S, Tran DD, Klebba-Farber S, Moran-Losada P, Wiehlmann L, Koch A, Chopra H, Pabst O, Hoffmann A, Klopfleisch R, Tamura T (2013) THOC5, a member of the mRNA export complex, contributes to processing of a subset of wingless/integrated (Wnt) target mRNAs and integrity of the gut epithelial barrier. BMC Cell Biol 14: 51
  8. ^ Griaud, F., Pierce, A., Gonzalez Sanchez, M.B., Scott, M., Abraham, S.A., Holyoake, T.L., Tran, D.D., Tamura, T., and Whetton, A.D. (2013). A pathway from leukemogenic oncogenes and stem cell chemokines to RNA processing via THOC5. Leukemia 27, 932-940.
  9. ^ Katahira J, Okuzaki D, Inoue H, Yoneda Y, Maehara K, Ohkawa Y (2013) Human TREX component Thoc5 affects alternative polyadenylation site choice by recruiting mammalian cleavage factor I. Nucleic Acids Research 41: 7060-7072
  10. ^ Katahira J, Inoue H, Hurt E, Yoneda Y (2009) Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA. The EMBO Journal 28: 556-567
  11. ^ Ramachandran S., Tran DD., Klebba-Faerber S., Kardinal C., Whetton AD., Tamura T. An ataxia-teleaniectasia-mutated (ATM) kinase mediated response to DNA damage down-regulates the mRNA-binding potential of THOC5. RNA 17(11):1957-66, 2011
  12. ^ Guria A., Tran D.D.H,Ramachandran S.,Koch A.,Bounkari O.,Dutta P,Hauser H,Tamura T. Identification of mRNAs that are spliced but not exported to the cytoplasm in the absence of THOC5 in mouse embryo fibroblasts, RNA, 2011 17:00-00.
  13. ^ Mancini, A., Niemann-Seyde, S. C., Pankow, R., El Bounkari, O., Klebba-Färber, S., Koch, A., EJaworska, E., Spooncer, E., Gruber, A. D. , Whetton, A. D., Tamura, T. (2010) THOC5/FMIP, an mRNA export TREX complex protein, is essential for hematopoietic primitive cell survival in vivo. BMC Biology 8, 1.
  14. ^ Mancini, A., El Bounkari, O., Norrenbrock, A-F., Scherr, M., Schaefer, D., Eder M., Banham, A. H., Pulford, K., Lyne, L., Whetton A. D., and Tamura, T. (2007) FMIP controls the adipocyte lineage commitment of C2C12 cells by down-modulation of C/EBPalpha. Oncogene 26, 1020-1027.
  15. ^ Mancini A., Koch A., Whetton A.D., and Tamura T. (2004)The M-CSF receptor substrate and interacting protein FMIP is governed in its subcellular localization by protein kinase C-mediated phosphorylation and thereby potentiates M-CSF-mediated differentiation. Oncogene, 23, 6581-9.
  16. ^ Tamura, T., Mancini, A., Joos, H., Koch, A., Hakim, C., Dumanski, J., Weidner, K.M., and Niemann, H. (1999) FMIP, a novel Fms-interacting protein, affects granulocyte/macrophage. Oncogene, 18, 6488-6495.
  17. ^ Strasser K, Masuda S, Mason P, Pfannstiel J, Oppizzi M, Rodriguez-Navarro S, Rondon AG, Aguilera A, Struhl K, Reed R, Hurt E (maj 2002). "TREX is a conserved complex coupling transcription with messenger RNA export". Nature. 417 (6886): 304–8. doi:10.1038/nature746. PMID 11979277. S2CID 1112194.
  18. ^ Xie YG, Han FY, Peyrard M, Ruttledge MH, Fransson I, DeJong P, Collins J, Dunham I, Nordenskjold M, Dumanski JP (Dec 1993). "Cloning of a novel, anonymous gene from a megabase-range YAC and cosmid contig in the neurofibromatosis type 2/meningioma region on human chromosome 22q12". Hum Mol Genet. 2 (9): 1361–8. doi:10.1093/hmg/2.9.1361. PMID 8242058.
  19. ^ Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O (Jul 1999). "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro". DNA Res. 6 (1): 63–70. doi:10.1093/dnares/6.1.63. PMID 10231032.
  20. ^ Carney L, Pierce A, Rijnen M, Gonzalez Sanchez MB, Hamzah HG, Zhang L, Tamura T, Whetton AD (Dec 2008). "THOC5 couples M-CSF receptor signaling to transcription factor expression". Cell Signal. 21 (2): 309–16. doi:10.1016/j.cellsig.2008.10.018. PMID 19015024.
  21. ^ Pierce A, Carney L, Hamza HG, Griffiths JR, Zhang L, Whetton BA, Gonzalez Sanchez MB, Tamura T, Sternberg D, Whetton AD (maj 2008). "THOC5 spliceosome protein: a target for leukaemogenic tyrosine kinases that affects inositol lipid turnover". Br J Haematol. 141 (5): 641–50. doi:10.1111/j.1365-2141.2008.07090.x. PMID 18373705. S2CID 21122818.
  22. ^ "Entrez Gene: THOC5 THO complex 5".

Dopinska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.