TFF2

TFF2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2DYZ, 2DZ0, 2DZ1

Identifikatori
AliasiTFF2
Vanjski ID-jeviOMIM: 182590 MGI: 1306805 HomoloGene: 3956 GeneCards: TFF2
Lokacija gena (čovjek)
Hromosom 21 (čovjek)
Hrom.Hromosom 21 (čovjek)[1]
Hromosom 21 (čovjek)
Genomska lokacija za TFF2
Genomska lokacija za TFF2
Bend21q22.3Početak42,346,357 bp[1]
Kraj42,350,997 bp[1]
Lokacija gena (miš)
Hromosom 17 (miš)
Hrom.Hromosom 17 (miš)[2]
Hromosom 17 (miš)
Genomska lokacija za TFF2
Genomska lokacija za TFF2
Bend17 A3.3|17 15.8 cMPočetak31,360,023 bp[2]
Kraj31,363,256 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
CXCR4 chemokine receptor binding
Ćelijska komponenta extracellular region
Vanćelijsko
Biološki proces Zarastanje rana
maintenance of gastrointestinal epithelium
negative regulation of gastric acid secretion
chemokine-mediated signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_005423

NM_009363

RefSeq (bjelančevina)

NP_005414

NP_033389

Lokacija (UCSC)Chr 21: 42.35 – 42.35 MbChr 17: 31.36 – 31.36 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Trefoilski faktor 2 jest protein koji je kod ljudi kodiran genom TFF2 sa hromosoma 21.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 129 aminokiselina, a molekulska težina 14.284 Da.[7]

1020304050
MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSD
QCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEE
CASRKCCFSNFIFEVPWCFFPKSVEDCHY

Funkcija

Članovi trefoilske porodice karakteriziraju postojanje najmanje jedne kopije motiva trefoila, domena od 40 aminokiselina koja sadrži tri konzervirana disulfida. Oni su stabilni sekretorni proteini eksprimirani u gastrointestinalnoj sluzokoži. Njihove funkcije nisu definirane, ali mogu zaštititi sluznicu od insulta, stabilizovati sloj sluzi i uticati na zarastanje epitela. Kodirani protein inhibira lučenje želučane kiseline. Ovaj gen i dva druga srodna gena člana porodice trefoila nalaze se u klasteru na hromosomu 21.[7]

Vezivanje glikana

Svi ljudski faktori trefoila su lektini koji specifično djeluju sa disaharidom GlcNAc-α-1,4-Gal.[8] Ovaj disaharid je neobičan glikotop za koji se zna da postoji samo na velikim, jako glikozilovanim, mucinima u sluznicama. Unakrsnim povezivanjem mucina putem dvovalentnog vezivanja ovog glikotopa, trefoilski faktori su tada u stanju da reverzibilno moduliraju debljinu i viskoznost sluzi.[8]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000160181 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000024028 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Tomasetto C, Rockel N, Mattei MG, Fujita R, Rio MC (Sep 1992). "The gene encoding the human spasmolytic protein (SML1/hSP) is in 21q 22.3, physically linked to the homologous breast cancer marker gene BCEI/pS2". Genomics. 13 (4): 1328–30. doi:10.1016/0888-7543(92)90059-2. PMID 1505966.
  6. ^ Gott P, Beck S, Machado JC, Carneiro F, Schmitt H, Blin N (maj 1997). "Human trefoil peptides: genomic structure in 21q22.3 and coordinated expression". Eur J Hum Genet. 4 (6): 308–15. doi:10.1159/000472224. PMID 9043862. S2CID 25235589.
  7. ^ a b c "Entrez Gene: TFF2 trefoil factor 2 (spasmolytic protein 1)".
  8. ^ a b Järvå MA, Lingford JP, John A, Soler NM, Scott NE, Goddard-Borger ED (maj 2020). "Trefoil factors share a lectin activity that defines their role in mucus". Nature Communications. 11 (1): 2265. Bibcode:2020NatCo..11.2265J. doi:10.1038/s41467-020-16223-7. PMC 7221086. PMID 32404934.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.