STC2

STC2
Identifikatori
AliasiSTC2
Vanjski ID-jeviOMIM: 603665 MGI: 1316731 HomoloGene: 2753 GeneCards: STC2
Lokacija gena (čovjek)
Hromosom 5 (čovjek)
Hrom.Hromosom 5 (čovjek)[1]
Hromosom 5 (čovjek)
Genomska lokacija za STC2
Genomska lokacija za STC2
Bend5q35.2Početak173,314,723 bp[1]
Kraj173,328,447 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za STC2
Genomska lokacija za STC2
Bend11|11 A4Početak31,307,307 bp[2]
Kraj31,320,074 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija protein homodimerization activity
hormone activity
heme binding
vezivanje enzima
Ćelijska komponenta Golđijev aparat
extracellular region
Endoplazmatski retikulum
perinuklearno područje citoplazme
Vanćelijsko
endoplasmic reticulum lumen
Biološki proces response to vitamin D
calcium ion homeostasis
negative regulation of multicellular organism growth
response to peptide hormone
cellular calcium ion homeostasis
regulation of hormone biosynthetic process
GO:0001306 response to oxidative stress
negative regulation of gene expression
response to endoplasmic reticulum stress
endoplasmic reticulum unfolded protein response
decidualization
regulation of store-operated calcium entry
cellular response to hypoxia
embryo implantation
Posttranslacione modifikacije
regulation of signaling receptor activity
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003714

NM_011491

RefSeq (bjelančevina)

NP_003705

NP_035621

Lokacija (UCSC)Chr 5: 173.31 – 173.33 MbChr 11: 31.31 – 31.32 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Staniokalcin-2 jest protein koji je kod ljudi kodiran genom STC2 sa hromosoma 5.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 302 aminokiseline, а molekulska težina 33.249 Da.[8]

1020304050
MCAERLGQFMTLALVLATFDPARGTDATNPPEGPQDRSSQQKGRLSLQNT
AEIQHCLVNAGDVGCGVFECFENNSCEIRGLHGICMTFLHNAGKFDAQGK
SFIKDALKCKAHALRHRFGCISRKCPAIREMVSQLQRECYLKHDLCAAAQ
ENTRVIVEMIHFKDLLLHEPYVDLVNLLLTCGEEVKEAITHSVQVQCEQN
WGSLCSILSFCTSAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPS
SRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDI
RR

Funkcija

Ovaj gen kodira izlučeni, homodimerni glikoprotein koji je eksprimiran u velikom broju tkiva i može imati autokrine ili parakrine funkcije. Kodirani protein ima 10 od svojih 15 konzerviranih cisteinskih ostataka među staniokalcinskim članovima porodice i fosforiliziranih pomoću kazein-kinaze 2 isključivo na svojim ostacima serina.

Njegov C-kraj sadrži skupinu histidinskih ostataka koji mogu stupiti u interakciju s metalnim ionima. Protein može imati ulogu u regulaciji transporta bubrežnog i crijevnog kalcija i fosfata, ćelijskog metabolizma ili homeostaze ćelijskog kalcija/fosfata. Konstitutivna prekomjerna ekspresija ljudskog staniokalcina 2 kod miševa rezultirala je pre- i postnatalnim ograničenjem rasta, smanjenim rastom kostiju i skeletnih mišića i organomegalijom. Ekspresiju ovog gena inducira estrogen i mijenja u nekim slučajevima raka dojke.[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000113739 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000020303 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Chang AC, Reddel RR (Nov 1998). "Identification of a second stanniocalcin cDNA in mouse and human: stanniocalcin 2". Mol Cell Endocrinol. 141 (1–2): 95–9. doi:10.1016/S0303-7207(98)00097-5. PMID 9723890. S2CID 28106090.
  6. ^ Ishibashi K, Miyamoto K, Taketani Y, Morita K, Takeda E, Sasaki S, Imai M (Nov 1998). "Molecular cloning of a second human stanniocalcin homologue (STC2)". Biochem Biophys Res Commun. 250 (2): 252–8. doi:10.1006/bbrc.1998.9300. PMID 9753616.
  7. ^ a b "Entrez Gene: STC2 stanniocalcin 2".
  8. ^ "UniProt, O76061" (jezik: engleski). Pristupljeno 20. 10. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.