STATH

STATH
Identifikatori
AliasiSTATH
Vanjski ID-jeviOMIM: 184470 HomoloGene: 88673 GeneCards: STATH
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za STATH
Genomska lokacija za STATH
Bend4q13.3Početak69,995,966 bp[1]
Kraj70,002,570 bp[1]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija extracellular matrix constituent, lubricant activity
hydroxyapatite binding
structural constituent of tooth enamel
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta extracellular region
Biološki proces defense response to bacterium
negative regulation of bone mineralization
ossification
saliva secretion
biomineral tissue development
regulation of bone mineralization
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003154
NM_001009181

n/a

RefSeq (bjelančevina)

NP_001009181
NP_003145

n/a

Lokacija (UCSC)Chr 4: 70 – 70 Mbn/a
PubMed pretraga[2]n/a
Wikipodaci
Pogledaj/uredi – čovjek

Staterin jest protein koji je kod ljudi kodiran genom STATH sa hromosoma 4.[3][4]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 62 aminokiseline, а molekulska težina 7.304 Da.[5]

1020304050
MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYP
QPYQPQYQQYTF

Funkcija

Ovaj protein sprečava taloženje kalcij-fosfata u pljuvački, održavajući visok nivo kalcijuma u dostupnog za remineralizaciju zubne cakline i visoke nivoe fosfata za puferovanje.[6]

Reference

  1. ^ a b c ENSG00000126549 GRCh38: Ensembl release 89: ENSG00000282891, ENSG00000126549 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ Sabatini LM, Carlock LR, Johnson GW, Azen EA (Jan 1988). "cDNA cloning and chromosomal localization (4q11-13) of a gene for statherin, a regulator of calcium in saliva". Am J Hum Genet. 41 (6): 1048–60. PMC 1684366. PMID 3502720.
  4. ^ "Entrez Gene: STATH statherin".
  5. ^ "UniProt, P02808" (jezik: engleski). Pristupljeno 31. 10. 2021.
  6. ^ Hay DI, Smith DJ, Schluckebier SK, Moreno EC (1984). "Relationship between concentration of human salivary statherin and inhibition of calcium phosphate precipitation in stimulated human parotid saliva". J. Dent. Res. 63 (6): 857–63. doi:10.1177/00220345840630060901. PMID 6429216. S2CID 72916849.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.