SPZ1

SPZ1
Identifikatori
AliasiSPZ1
Vanjski ID-jeviOMIM: 618068 MGI: 1930801 HomoloGene: 49934 GeneCards: SPZ1
Lokacija gena (čovjek)
Hromosom 5 (čovjek)
Hrom.Hromosom 5 (čovjek)[1]
Hromosom 5 (čovjek)
Genomska lokacija za SPZ1
Genomska lokacija za SPZ1
Bend5q14.1Početak80,319,625 bp[1]
Kraj80,321,842 bp[1]
Lokacija gena (miš)
Hromosom 13 (miš)
Hrom.Hromosom 13 (miš)[2]
Hromosom 13 (miš)
Genomska lokacija za SPZ1
Genomska lokacija za SPZ1
Bend13|13 C3Početak92,711,144 bp[2]
Kraj92,712,680 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija vezivanje sa DNK
GO:0001948, GO:0016582 vezivanje za proteine
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
Ćelijska komponenta citoplazma
jedro
Biološki proces transcription, DNA-templated
GO:0009373 regulation of transcription, DNA-templated
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_032567

NM_030237

RefSeq (bjelančevina)

NP_115956

NP_084513

Lokacija (UCSC)Chr 5: 80.32 – 80.32 MbChr 13: 92.71 – 92.71 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein 1 spermatogenog leucinskog zatvarača jest protein koji je kod ljudi kodiran genom SPZ1 sa hromosoma 5. is a protein that in humans is encoded by the [[gen.[5][6][7][8][9][10]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 430 aminokiselina, а molekulska težina 49.445 Da.[11]

1020304050
MASSAKSAEMPTISKTVNPTPDPHQEYLDPRITIALFEIGSHSPSSWGSL
PFLKNSSHQVTEQQTAQKFNNLLKEIKDILKNMAGFEEKITEAKELFEET
NITEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEKKQEMILETNI
TEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEKKQQMIMENQNSE
NTAQVFARDLVNRLEEKKVLNETQQSQEKAKNRLNVQEETMKIRNNMEQL
LQEAEHWSKQHTELSKLIKSYQKSQKDISETLGNNGVGFQTQPNNEVSAK
HELEEQVKKLSHDTYSLQLMAALLENECQILQQRVEILKELHHQKQGTLQ
EKPIQINYKQDKKNQKPSEAKKVEMYKQNKQAMKGTFWKKDRSCRSLDVC
LNKKACNTQFNIHVARKALRGKMRSASSLR

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000164299 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000046957 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Hsu SH, Shyu HW, Hsieh-Li HM, Li H (Feb 2001). "Spz1, a novel bHLH-Zip protein, is specifically expressed in testis". Mech Dev. 100 (2): 177–87. doi:10.1016/S0925-4773(00)00513-X. PMID 11165476. S2CID 17206805.
  6. ^ Sha JH, Zhou ZM, Li JM, Lin M, Zhu H, Zhu H, Zhou YD, Wang LL, Wang YQ, Zhou KY (Jun 2003). "Expression of a novel bHLH-Zip gene in human testis". Asian J Androl. 5 (2): 83–8. PMID 12778315.
  7. ^ Hrabchak C, Varmuza S (Aug 2004). "Identification of the spermatogenic zip protein Spz1 as a putative protein phosphatase-1 (PP1) regulatory protein that specifically binds the PP1cgamma2 splice variant in mouse testis". J Biol Chem. 279 (35): 37079–86. doi:10.1074/jbc.M403710200. PMID 15226296.
  8. ^ Horowitz E, Zhang Z, Jones BH, Moss SB, Ho C, Wood JR, Wang X, Sammel MD, Strauss JF 3rd (Apr 2005). "Patterns of expression of sperm flagellar genes: early expression of genes encoding axonemal proteins during the spermatogenic cycle and shared features of promoters of genes encoding central apparatus proteins". Mol Hum Reprod. 11 (4): 307–17. doi:10.1093/molehr/gah163. PMID 15829580.
  9. ^ Hsu SH, Hsieh-Li HM, Huang HY, Huang PH, Li H (maj 2005). "bHLH-zip transcription factor Spz1 mediates mitogen-activated protein kinase cell proliferation, transformation, and tumorigenesis". Cancer Res. 65 (10): 4041–50. doi:10.1158/0008-5472.CAN-04-3658. PMID 15899793.
  10. ^ "Entrez Gene: SPZ1 spermatogenic leucine zipper 1".
  11. ^ "UniProt, Q9BXG8" (jezik: engleski). Pristupljeno 20. 10. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.