SMIM20

SMIM20
Identifikatori
AliasiSMIM20
Vanjski ID-jeviOMIM: 617465 MGI: 1913528 HomoloGene: 82612 GeneCards: SMIM20
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za SMIM20
Genomska lokacija za SMIM20
Bend4p15.2Početak25,861,830 bp[1]
Kraj25,929,813 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za SMIM20
Genomska lokacija za SMIM20
Bend5|5 C1Početak53,424,425 bp[2]
Kraj53,435,882 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta membrana
integral component of membrane
mitohondrija
mitochondrial inner membrane
Biološki proces mitochondrial cytochrome c oxidase assembly
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001145432
NM_001394130

NM_001145433

RefSeq (bjelančevina)

NP_001138904

NP_001138905

Lokacija (UCSC)Chr 4: 25.86 – 25.93 MbChr 5: 53.42 – 53.44 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Mali integralni membranski protein (SMIM) 20 jest protein koji je kod ljudi kodiran genom SMIM20 sa hromosoma 4.[5] SMIM20 djeluje kao prohormon na peptidni hormon feniksin koji je prvi put otkriven 2013. godine u senzornim ganglijama glodara.[6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 67 aminokiselina, а molekulska težina 7.702 Da.[7]

1020304050
MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQE
DVQPPGLKVWSDPFGRK

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000250317 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000061461 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Small integral membrane protein 20". Pristupljeno 5. 2. 2014.
  6. ^ Neuroscience. 2013 Oct 10;250:622-31. doi: 10.1016 Yosten, G. L., Lyu, R. M., Hsueh, A. J., Avsian‐Kretchmer, O., Chang, J. K., Tullock, C. W., ... & Samson, W. K. (2013). A novel reproductive peptide, phoenixin. Journal of neuroendocrinology, 25(2), 206-215.
  7. ^ "UniProt, Q8N5G0" (jezik: engleski). Pristupljeno 31. 10. 2021.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.