RGS2

RGS2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2AF0, 2V4Z, 4EKC, 4EKD

Identifikatori
AliasiRGS2
Vanjski ID-jeviOMIM: 600861 MGI: 1098271 HomoloGene: 2192 GeneCards: RGS2
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za RGS2
Genomska lokacija za RGS2
Bend1q31.2Početak192,809,039 bp[1]
Kraj192,812,275 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za RGS2
Genomska lokacija za RGS2
Bend1 F|1 62.56 cMPočetak143,875,076 bp[2]
Kraj143,879,899 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0005097, GO:0005099, GO:0005100 GTPase activator activity
calmodulin binding
GO:0001948, GO:0016582 vezivanje za proteine
G-protein alpha-subunit binding
beta-tubulin binding
GO:0006184 GTPase activity
Ćelijska komponenta membrana
Jedarce
mitohondrija
neuron projection
cytoplasmic side of plasma membrane
jedro
citoplazma
ćelijska membrana
citosol
Biološki proces negative regulation of cAMP-mediated signaling
regulation of G protein-coupled receptor signaling pathway
negative regulation of cardiac muscle hypertrophy
GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
negative regulation of MAP kinase activity
positive regulation of cardiac muscle contraction
Spermatogeneza
brown fat cell differentiation
positive regulation of microtubule polymerization
relaxation of vascular associated smooth muscle
ćelijski ciklus
negative regulation of signal transduction
negative regulation of G protein-coupled receptor signaling pathway
relaxation of cardiac muscle
regulation of translation
negative regulation of phospholipase activity
negative regulation of adenylate cyclase-inhibiting adrenergic receptor signaling pathway involved in heart process
response to amphetamine
brain development
positive regulation of neuron projection development
negative regulation of translation
ovulacija
response to ethanol
maternal process involved in female pregnancy
negative regulation of cell growth involved in cardiac muscle cell development
negative regulation of glycine import across plasma membrane
G protein-coupled receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_002923

NM_009061

RefSeq (bjelančevina)

NP_002914
NP_002914.1

NP_033087

Lokacija (UCSC)Chr 1: 192.81 – 192.81 MbChr 1: 143.88 – 143.88 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Regulator G-proteinske signalizacije 2 jest protein koji je kod ljudi kodiran genom RGS2 sa hromosoma 1.[5][6] Dio je velike porodice RGS-proteina koja kontrolira signalzaciju, putem G-protein spregnutih receptora (GPCR).

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 211 aminokiselina, a molekulska težina 24 382 Da.[7]

1020304050
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQ
NSSTPGKPKTGKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAF
LKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINI
DFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCK
KPQITTEPHAT

Funkcija

Smatra se da RGS2 ima zaštitne efekte protiv hipertrofije miokarda, kao i pretkomorskih aritmija.[8][9] Povećan stimulacija Gs povezanih β1-adrenergičnih receptor i Gq]] povezanih α1-adrenergičnih receptora u srcu može dovesti do hipertrofije srca.[8] U slučaju hipertrofije posredovane Gq proteinskim receptorom (GqPCR), Gαq će aktivirati unutarćelijske afektore fosfolipaza Cβ i rho guaninski faktor razmjene nukleotida da stimulira ćelijske procese koji dovode do hipertrofije kardiomiocita.[8][10] RGS2 funkcionira kao protein koji aktivira GTP-azu (GAP) koja djeluje na povećanje prirodne GTPazne aktivnosti podjedinice Gα.[8][10] Povećanjem GTPazne aktivnosti Gα podjedinice, RGS2 promovira GTP hidrolizu nazad u GDP, pretvarajući tako podjedinicu Gα nazad u njeno neaktivno stanje i smanjujući njenu signalnu sposobnost.[10] I GsPCR i GqPCR aktivacija mogu doprinijeti srčanoj hipertrofiji putem aktivacije MAP-kinaza. Pokazalo se da RGS2 smanjuje fosforilaciju tih MAP-kinaza i stoga smanjuje njihovu aktivaciju kao odgovor na Gαs-signalizaciju.[8]

U slučaju hipertrofije posredovane GsPCR, glavni mehanizam kojim signalizacija doprinosi hipertrofiji je putem podjedinice Gβγ; Gαs signalizacija sama po sebi nije dovoljna.[11] Ipak, pokazalo se da RGS2 inhibira Gs posredovanu hipertrofiju. Mehanizam kako RGS2 reguliše povećanu Gβγ signalizaciju nije dobro shvaćen, osim činjenice da nije povezan sa GAP funkcijom RGS2a.[11] Nedostatak RGS2 je povezan sa povećanom hipertrofijom srca kod miševa.[8] Srca s nedostatkom RGS2 izgledaju normalno, sve dok se ne suoče s povećanim opterećenjem, na koje spremno reagiraju pojačanim signalom Gαq i hipertrofijom.[8][11]

Interakcije

Pokazalo se da RGS2 interraguje sa PRKG1[12] i ADCY5.[13]

Reference

{{reflist|refs=

[8]

[9]

[10]

[14]

Dopunska literatura

Vanjski linkovi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000116741 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000026360 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Siderovski DP, Heximer SP, Forsdyke DR (Jun 1994). "A human gene encoding a putative basic helix-loop-helix phosphoprotein whose mRNA increases rapidly in cycloheximide-treated blood mononuclear cells". DNA Cell Biol. 13 (2): 125–47. doi:10.1089/dna.1994.13.125. PMID 8179820.
  6. ^ "RGS2 regulator of G-protein signaling 2, 24kDa".
  7. ^ "UniProt, P41220" (jezik: engleski). Pristupljeno 17. 12. 2021.
  8. ^ a b c d e f g h Nunn C, Zou MX, Sobiesiak AJ, Roy AA, Kirshenbaum LA, Chidiac P (august 2010). "RGS2 inhibits beta-adrenergic receptor-induced cardiomyocyte hypertrophy". Cell. Signal. 22 (8): 1231–9. doi:10.1016/j.cellsig.2010.03.015. PMID 20362664.
  9. ^ a b Tuomi JM, Chidiac P, Jones DL (februar 2010). "Evidence for enhanced M3 muscarinic receptor function and sensitivity to atrial arrhythmia in the RGS2-deficient mouse". Am. J. Physiol. Heart Circ. Physiol. 298 (2): H554–61. doi:10.1152/ajpheart.00779.2009. PMID 19966055.
  10. ^ a b c d Park-Windhol C, Zhang P, Zhu M, Su J, Chaves L, Maldonado AE, King ME, Rickey L, Cullen D, Mende U (2012). "Gq/11-mediated signaling and hypertrophy in mice with cardiac-specific transgenic expression of regulator of G-protein signaling 2". PLOS ONE. 7 (7): e40048. Bibcode:2012PLoSO...740048P. doi:10.1371/journal.pone.0040048. PMC 3388988. PMID 22802950.
  11. ^ a b c Vidal M, Wieland T, Lohse MJ, Lorenz K (novembar 2012). "β-Adrenergic receptor stimulation causes cardiac hypertrophy via a Gβγ/Erk-dependent pathway". Cardiovasc. Res. 96 (2): 255–64. doi:10.1093/cvr/cvs249. PMID 22843704.
  12. ^ Tang KM, Wang GR, Lu P, Karas RH, Aronovitz M, Heximer SP, Kaltenbronn KM, Blumer KJ, Siderovski DP, Zhu Y, Mendelsohn ME, Tang M, Wang G (decembar 2003). "Regulator of G-protein signaling-2 mediates vascular smooth muscle relaxation and blood pressure". Nat. Med. 9 (12): 1506–12. doi:10.1038/nm958. PMID 14608379. S2CID 20331752.
  13. ^ Salim S, Sinnarajah S, Kehrl JH, Dessauer CW (maj 2003). "Identification of RGS2 and type V adenylyl cyclase interaction sites". J. Biol. Chem. 278 (18): 15842–9. doi:10.1074/jbc.M210663200. PMID 12604604.
  14. ^ Wieland T, Lutz S, Chidiac P (april 2007). "Regulators of G protein signalling: a spotlight on emerging functions in the cardiovascular system". Curr Opin Pharmacol. 7 (2): 201–7. doi:10.1016/j.coph.2006.11.007. PMID 17276730.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.