RELT

RELT
Identifikatori
AliasiRELT
Vanjski ID-jeviOMIM: 611211 MGI: 2443373 HomoloGene: 13151 GeneCards: RELT
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za RELT
Genomska lokacija za RELT
Bend11q13.4Početak73,376,399 bp[1]
Kraj73,397,474 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za RELT
Genomska lokacija za RELT
Bend7|7 E2Početak100,495,054 bp[2]
Kraj100,512,653 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija tumor necrosis factor-activated receptor activity
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta citoplazma
integral component of membrane
ćelijska membrana
integral component of plasma membrane
membrana
jedro
perinuklearno područje citoplazme
Biološki proces multicellular organism development
regulation of apoptotic process
apoptotic signaling pathway
response to lipopolysaccharide
inflammatory response
regulation of cell population proliferation
GO:0046730, GO:0046737, GO:0046738, GO:0046736 Imuni odgovor
tumor necrosis factor-mediated signaling pathway
GO:0097285 apoptoza
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_032871
NM_152222

NM_177073
NM_001358914

RefSeq (bjelančevina)

NP_116260
NP_689408

NP_796047
NP_001345843

Lokacija (UCSC)Chr 11: 73.38 – 73.4 MbChr 7: 100.5 – 100.51 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Član 19L supertporodice receptora tumorske necroze je protein koji je kod ljudi kodiran genom RELT.[5][6][7][8][9]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 430 aminokiselina, a molekulska težina 46.092 Da.[10]

1020304050
MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRP
CPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGP
WGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNG
TRAGGPEETAAQYAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKEVG
PGPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHS
KQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQ
KKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRF
RVARIPEQRTSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGG
SRTKWLKPPAENKAEENRYVVRLSESNLVI

Funkcija

Protein kodiran ovim genom je član natporodice TNF-receptora. Ovaj receptor je posebno bogat krvnim tkivima. Pokazalo se da aktivira NF-kapaB put i selektivno veže faktor 1 (TRAF1) povezan sa TNF receptorima. Ovaj receptor je sposoban stimulirati proliferaciju T-ćelija u prisustvu signala CD3, što sugerira njegovu regulatornu ulogu u imunskom odgovoru. Prijavljene su dvije alternativno prerađene varijante transkripta ovog gena koje kodiraju isti protein.[9]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000054967 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000008318 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Sica GL, Zhu G, Tamada K, Liu D, Ni J, Chen L (Apr 2001). "RELT, a new member of the tumor necrosis factor receptor superfamily, is selectively expressed in hematopoietic tissues and activates transcription factor NF-kappaB". Blood. 97 (9): 2702–7. doi:10.1182/blood.V97.9.2702. PMID 11313261. S2CID 6347356.
  6. ^ Bossen C, Ingold K, Tardivel A, Bodmer JL, Gaide O, Hertig S, Ambrose C, Tschopp J, Schneider P (maj 2006). "Interactions of tumor necrosis factor (TNF) and TNF receptor family members in the mouse and human". J Biol Chem. 281 (20): 13964–71. doi:10.1074/jbc.M601553200. PMID 16547002.
  7. ^ Polek TC, Talpaz M, Spivak-Kroizman TR (Sep 2006). "TRAIL-induced cleavage and inactivation of SPAK sensitizes cells to apoptosis". Biochem Biophys Res Commun. 349 (3): 1016–24. doi:10.1016/j.bbrc.2006.08.118. PMID 16950202.
  8. ^ Cusick JK, Xu LG, Bin LH, Han KJ, Shu HB (Jan 2006). "Identification of RELT homologues that associate with RELT and are phosphorylated by OSR1". Biochem Biophys Res Commun. 340 (2): 535–43. doi:10.1016/j.bbrc.2005.12.033. PMID 16389068.
  9. ^ a b "Entrez Gene: TNFRSF19L tumor necrosis factor receptor superfamily, member 19-like".
  10. ^ "UniProt, Q969Z4". Pristupljeno 26. 8. 2021.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.