RCP9

RCP9
Identifikatori
AliasiCRCP
Vanjski ID-jeviOMIM: 606121 MGI: 1100818 HomoloGene: 40587 GeneCards: CRCP
Lokacija gena (čovjek)
Hromosom 7 (čovjek)
Hrom.Hromosom 7 (čovjek)[1]
Hromosom 7 (čovjek)
Genomska lokacija za RCP9
Genomska lokacija za RCP9
Bend7q11.21Početak66,114,604 bp[1]
Kraj66,154,568 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za RCP9
Genomska lokacija za RCP9
Bend5|5 G1.3Početak130,058,131 bp[2]
Kraj130,089,630 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
RNA polymerase III activity
DNA-directed 5'-3' RNA polymerase activity
GO:0001948, GO:0016582 vezivanje za proteine
catalytic activity
calcitonin gene-related peptide receptor activity
Ćelijska komponenta citosol
membrana
ćelijska membrana
nukleoplazma
Akrozom
DNA polymerase III complex
jedro
RNA polymerase III complex
nuclear DNA-directed RNA polymerase complex
RNA polymerase complex
Biološki proces immune system process
cell metabolism
defense response to virus
neuropeptide signaling pathway
transcription by RNA polymerase III
Urođeni imunski sistem
DNA-templated transcription, initiation
transcription initiation from RNA polymerase III promoter
positive regulation of type I interferon production
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001040647
NM_001040648
NM_001142414
NM_014478

NM_007761

RefSeq (bjelančevina)

NP_001035737
NP_001035738
NP_001135886
NP_055293

NP_031787

Lokacija (UCSC)Chr 7: 66.11 – 66.15 MbChr 5: 130.06 – 130.09 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica RPC9 DNK-usmjerene RNK polimeraze III je enzim koji je kod ljudi kodiran genom CRCP.[5][6][7][8]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 148 aminokiselina, а molekulska težina 16.871 Da.[9]

1020304050
MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETL
KYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLM
VEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

Funkcija

Ovaj gen kodira membranski protein koji funkcionira kao dio receptorskog kompleksa za mali neuropeptid koji povećava unutarćelijske nivoe cAMP-a. Opisane su alternativno prerađene varijante transkripcije, koje kodiraju različite izoforme.[8]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000241258 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000025532 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Luebke AE, Dahl GP, Roos BA, Dickerson IM (Jun 1996). "Identification of a protein that confers calcitonin gene-related peptide responsiveness to oocytes by using a cystic fibrosis transmembrane conductance regulator assay". Proc Natl Acad Sci U S A. 93 (8): 3455–60. doi:10.1073/pnas.93.8.3455. PMC 39630. PMID 8622957.
  6. ^ Balkan W, Oates EL, Howard GA, Roos BA (Mar 1999). "Testes exhibit elevated expression of calcitonin gene-related peptide receptor component protein". Endocrinology. 140 (3): 1459–69. doi:10.1210/en.140.3.1459. PMID 10067875.
  7. ^ Siaut M, Zaros C, Levivier E, Ferri ML, Court M, Werner M, Callebaut I, Thuriaux P, Sentenac A, Conesa C (Dec 2002). "An Rpb4/Rpb7-Like Complex in Yeast RNA Polymerase III Contains the Orthologue of Mammalian CGRP-RCP". Mol Cell Biol. 23 (1): 195–205. doi:10.1128/MCB.23.1.195-205.2003. PMC 140662. PMID 12482973.
  8. ^ a b "Entrez Gene: RCP9 calcitonin gene-related peptide-receptor component protein".
  9. ^ "UniProt, O75575" (jezik: engleski). Pristupljeno 28. 9. 2021.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.