PSEN2

PSEN2
Identifikatori
AliasiPSEN2
Vanjski ID-jeviOMIM: 600759 MGI: 109284 HomoloGene: 386 GeneCards: PSEN2
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za PSEN2
Genomska lokacija za PSEN2
Bend1q42.13Početak226,870,184 bp[1]
Kraj226,927,726 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za PSEN2
Genomska lokacija za PSEN2
Bend1 H4|1 84.19 cMPočetak180,054,569 bp[2]
Kraj180,091,003 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija endopeptidase activity
GO:0070122 peptidase activity
GO:0001948, GO:0016582 vezivanje za proteine
hydrolase activity
aspartic endopeptidase activity, intramembrane cleaving
aspartic-type endopeptidase activity
Ćelijska komponenta integral component of membrane
centrosom
Golđijev aparat
endoplasmic reticulum membrane
membrana
Golđijeva membrana
ćelijska membrana
integral component of plasma membrane
soma
nuclear inner membrane
Z discdkac
Endoplazmatski retikulum
perinuklearno područje citoplazme
kinetohor
mitochondrial inner membrane
lysosomal membrane
cell cortex
cell surface
Akson
growth cone
Nervno-mišićna veza
ciliary rootlet
dendritic shaft
Lipidni splav
jedro
early endosome
Sinapsna vezikula
apical plasma membrane
GO:0009327 makromolekulani kompleks
synaptic membrane
integral component of presynaptic membrane
intracellular anatomical structure
Biološki proces Notch signaling pathway
GO:0007243 intracellular signal transduction
response to hypoxia
ephrin receptor signaling pathway
protein processing
GO:0048554 positive regulation of catalytic activity
negative regulation of apoptotic process
amyloid-beta metabolic process
Proteoliza
membrane protein ectodomain proteolysis
membrane protein intracellular domain proteolysis
positive regulation of apoptotic process
Notch receptor processing
calcium ion transport
amyloid precursor protein catabolic process
Notch receptor processing, ligand-dependent
regulation of calcium import into the mitochondrion
mitochondrion-endoplasmic reticulum membrane tethering
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000447
NM_012486

NM_001128605
NM_011183

RefSeq (bjelančevina)

NP_000438
NP_036618

NP_001122077
NP_035313

Lokacija (UCSC)Chr 1: 226.87 – 226.93 MbChr 1: 180.05 – 180.09 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Presenilin-2 jest protein koji je kod ljudi kodiran genom PSEN2 sa hromosoma 1.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 448 aminokiselina, a molekulska težina 50.140 Da.[6]

1020304050
MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQ
ENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMI
VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
VMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMD
YPTLLLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMALVFIKYLPEW
SAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVW
TVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGE
ELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLC
LTLLLLAVFKKALPALPISITFGLIFYFSTDNLVRPFMDTLASHQLYI

Funkcija

Kod Alzheimerove bolesti (AD), pacijenti sa naslijeđenim oblikom nose mutacije u presenilinskim proteinima (PSEN1; PSEN2) ili amiloidnom prekursoru proteina (APP). Ove mutacije povezane s bolešću rezultiraju povećanom proizvodnjom dužeg oblika varijante amiloid-beta (glavna komponenta amiloidnih naslaga pronađenih u mozgu AD). Pretpostavlja se da presenilini reguli procesiranje APP kroz svoje efekte na gama-sekretazu, enzim koji cijepa APP. Takođe, smatra se da su presenilini uključeni u cepanje Notch receptora, tako da oni ili direktno regulišu aktivnost gama-sekretaze ili su sami proteaza enzimi. Identifikovana su dva alternativna transkripta PSEN2.[7]

U melanocitnim ćelijama, ekspresija gena PSEN2 može biti regulirana MITF-om.[8]

Interakcije

Pokazalo se da PSEN2 u u interakciji sa:

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000143801 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000010609 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Levy-Lahad E, Wasco W, Poorkaj P, Romano DM, Oshima J, Pettingell WH, Yu CE, Jondro PD, Schmidt SD, Wang K (septembar 1995). "Candidate gene for the chromosome 1 familial Alzheimer's disease locus". Science. 269 (5226): 973–977. Bibcode:1995Sci...269..973L. doi:10.1126/science.7638622. PMID 7638622. S2CID 27296868.
  6. ^ "UniProt, P49810" (jezik: engleski). Pristupljeno 16. 12. 2021.
  7. ^ "Entrez Gene: PSEN2 presenilin 2 (Alzheimer disease 4)".
  8. ^ Hoek KS, Schlegel NC, Eichhoff OM, Widmer DS, Praetorius C, Einarsson SO, Valgeirsdottir S, Bergsteinsdottir K, Schepsky A, Dummer R, Steingrimsson E (2008). "Novel MITF targets identified using a two-step DNA microarray strategy". Pigment Cell Melanoma Res. 21 (6): 665–676. doi:10.1111/j.1755-148X.2008.00505.x. PMID 19067971.
  9. ^ Passer BJ, Pellegrini L, Vito P, Ganjei JK, D'Adamio L (august 1999). "Interaction of Alzheimer's presenilin-1 and presenilin-2 with Bcl-X(L). A potential role in modulating the threshold of cell death". J. Biol. Chem. 274 (34): 24007–13. doi:10.1074/jbc.274.34.24007. PMID 10446169.
  10. ^ Shinozaki K, Maruyama K, Kume H, Tomita T, Saido TC, Iwatsubo T, Obata K (maj 1998). "The presenilin 2 loop domain interacts with the mu-calpain C-terminal region". Int. J. Mol. Med. 1 (5): 797–9. doi:10.3892/ijmm.1.5.797. PMID 9852298.
  11. ^ Stabler SM, Ostrowski LL, Janicki SM, Monteiro MJ (juni 1999). "A myristoylated calcium-binding protein that preferentially interacts with the Alzheimer's disease presenilin 2 protein". J. Cell Biol. 145 (6): 1277–92. doi:10.1083/jcb.145.6.1277. PMC 2133148. PMID 10366599.
  12. ^ Buxbaum JD, Choi EK, Luo Y, Lilliehook C, Crowley AC, Merriam DE, Wasco W (oktobar 1998). "Calsenilin: a calcium-binding protein that interacts with the presenilins and regulates the levels of a presenilin fragment". Nat. Med. 4 (10): 1177–81. doi:10.1038/2673. PMID 9771752. S2CID 10799492.
  13. ^ Choi EK, Zaidi NF, Miller JS, Crowley AC, Merriam DE, Lilliehook C, Buxbaum JD, Wasco W (juni 2001). "Calsenilin is a substrate for caspase-3 that preferentially interacts with the familial Alzheimer's disease-associated C-terminal fragment of presenilin 2". J. Biol. Chem. 276 (22): 19197–204. doi:10.1074/jbc.M008597200. PMID 11278424.
  14. ^ Tanahashi H, Tabira T (septembar 2000). "Alzheimer's disease-associated presenilin 2 interacts with DRAL, an LIM-domain protein". Hum. Mol. Genet. 9 (15): 2281–9. doi:10.1093/oxfordjournals.hmg.a018919. PMID 11001931.
  15. ^ Zhang W, Han SW, McKeel DW, Goate A, Wu JY (februar 1998). "Interaction of presenilins with the filamin family of actin-binding proteins". J. Neurosci. 18 (3): 914–22. doi:10.1523/JNEUROSCI.18-03-00914.1998. PMC 2042137. PMID 9437013.
  16. ^ Morohashi Y, Hatano N, Ohya S, Takikawa R, Watabiki T, Takasugi N, Imaizumi Y, Tomita T, Iwatsubo T (april 2002). "Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4". J. Biol. Chem. 277 (17): 14965–75. doi:10.1074/jbc.M200897200. PMID 11847232.
  17. ^ Lee SF, Shah S, Li H, Yu C, Han W, Yu G (novembar 2002). "Mammalian APH-1 interacts with presenilin and nicastrin and is required for intramembrane proteolysis of amyloid-beta precursor protein and Notch". J. Biol. Chem. 277 (47): 45013–9. doi:10.1074/jbc.M208164200. PMID 12297508.
  18. ^ Yu G, Nishimura M, Arawaka S, Levitan D, Zhang L, Tandon A, Song YQ, Rogaeva E, Chen F, Kawarai T, Supala A, Levesque L, Yu H, Yang DS, Holmes E, Milman P, Liang Y, Zhang DM, Xu DH, Sato C, Rogaev E, Smith M, Janus C, Zhang Y, Aebersold R, Farrer LS, Sorbi S, Bruni A, Fraser P, St George-Hyslop P (septembar 2000). "Nicastrin modulates presenilin-mediated notch/glp-1 signal transduction and betaAPP processing". Nature. 407 (6800): 48–54. Bibcode:2000Natur.407...48Y. doi:10.1038/35024009. PMID 10993067. S2CID 4339220.
  19. ^ Mah AL, Perry G, Smith MA, Monteiro MJ (novembar 2000). "Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation". J. Cell Biol. 151 (4): 847–62. doi:10.1083/jcb.151.4.847. PMC 2169435. PMID 11076969.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.