PRAME

PRAME
Identifikatori
AliasiPRAME
Vanjski ID-jeviOMIM: 606021 HomoloGene: 48404 GeneCards: PRAME
Lokacija gena (čovjek)
Hromosom 22 (čovjek)
Hrom.Hromosom 22 (čovjek)[1]
Hromosom 22 (čovjek)
Genomska lokacija za PRAME
Genomska lokacija za PRAME
Bend22q11.22Početak22,547,701 bp[1]
Kraj22,559,361 bp[1]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
retinoic acid receptor binding
Ćelijska komponenta ćelijska membrana
jedro
membrana
citoplazma
Biološki proces negative regulation of cell differentiation
regulation of growth
Ćelijska diferencijacija
negative regulation of apoptotic process
GO:0045996 negative regulation of transcription, DNA-templated
GO:0009373 regulation of transcription, DNA-templated
transcription, DNA-templated
positive regulation of cell population proliferation
GO:0097285 apoptoza
negative regulation of retinoic acid receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001291715
NM_001291716
NM_001291717
NM_001291719
NM_006115

NM_206953
NM_206954
NM_206955
NM_206956
NM_001318126
NM_001318127

n/a

RefSeq (bjelančevina)
NP_001278644
NP_001278645
NP_001278646
NP_001278648
NP_001305055

NP_001305056
NP_006106
NP_996836
NP_996837
NP_996838
NP_996839

n/a

Lokacija (UCSC)Chr 22: 22.55 – 22.56 Mbn/a
PubMed pretraga[2]n/a
Wikipodaci
Pogledaj/uredi – čovjek

Melanomski antigen prioritetno eksprimiran u tumorima jest protein koji je kod ljudi kodiran genom PRAME sa hromosoma 22.[3][4][5] Za ovaj gen je uočeno pet alternativno prerađenih varijanti transkripta koje kodiraju isti protein.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 509 aminokiselina, a molekulska težina 57.890 Da.[5]

1020304050
MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPR
ELFPPLFMAAFDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAV
LDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPE
AAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVK
RKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLA
KFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQA
LYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQ
LSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLP
SLSHCSQLTTLSFYGNSISISALQSLLQHLIGLSNLTHVLYPVPLESYED
IHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRTFYDPEP
ILCPCFMPN

Funkcija

Ovaj gen kodira antigen koji je pretežno eksprimiran u ljudskim melanomima i koji prepoznaju citolitski T-limfociti. Ne eksprimira se u normalnim tkivima, osim u testisima. Ovaj obrazac ekspresije je sličan onom kod drugih CT-antigena, kao što su antigen povezan sa melanomom (MAGE), BAGE i GAGE. Međutim, za razliku od ovih drugih CT-antigena, ovaj gen je također eksprimiran kod akutnih leukemija. Prekomjerna ekspresija PRAME u tumorskim tkivima i relativno niski nivoi u normalnim somatskim tkivima čine ga privlačnom metom za terapiju raka. Posljednjih godina imunoterapija je predvodila novu eru terapije raka što je rezultiralo razvojem brojnih novih antigen-specifičnih imunoterapijskih pristupa. Studije o PRAME-specifičnoj imunoterapiji prvenstveno uključuju vakcine i ćelijske imunoterapije.[6]

PRAME može inhibirati signalizaciju retinoinske kiseline i njeno posredovanje u diferencijaciji i apoptozama.[7] Utvrđeno je da prekomjerna ekspresija PRAME kod trostruko negativnog karcinoma dojke podstiče pokretljivost ćelija raka indukcijom tranzicije epitela u mezenhim.[8]

Modelni organizmi

U proučavanju funkcije korišteni su i PRAME modelni organizmi. Uslovna nokaut-mišja linija pod nazivom Prametm1a(KOMP)Wtsi generirana je u Institutu Wellcome Trust Sanger.[9] Muškarci i ženke podvrgnuti su standardizovanom fenotipskom pregledu[10] to determine the effects of deletion.[11][12][13][14] Urađeni su dodatni pregledi: Dubinska imunološka fenotipizacija.[15]

Fenotip Prame nokaut-miševa
Svojstvo Fenotip
Svi podaci rasoloživi na:[10][15]
Insulin Normalan
Vijabilnost homozigota na P14 Normalan
Plodnost homozigota Normalan
Tjelesna težina Normalan
Neurološka procjena Normalan
Snaga stiska Normalan
Dismorfologija Normalan
Indirektna kalorimetrija Normalan
Test tolerancije glukoze Normalan
Slušni odgovor moždanog stabla Normalan
DEXA Normalan
Radiografija Normalan
Morfologija oka Normalan
Klinička hemija Normalan
Hematologija 16sedmica Normalan
Leukociti periferne krvi 16 sedmica Normalan
Salmonella infekcija Normalan
Imunofenotipizacija slezene Normalan
Imunofenotipizacija mezenternog limfnog čvora Normalan
Kompozicija epidermne imunosti Nenormalan

Reference

  1. ^ a b c ENSG00000275013 GRCh38: Ensembl release 89: ENSG00000185686, ENSG00000275013 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ Ikeda H, Lethé B, Lehmann F, van Baren N, Baurain JF, de Smet C, Chambost H, Vitale M, Moretta A, Boon T, Coulie PG (Feb 1997). "Characterization of an antigen that is recognized on a melanoma showing partial HLA loss by CTL expressing an NK inhibitory receptor". Immunity. 6 (2): 199–208. doi:10.1016/S1074-7613(00)80426-4. PMID 9047241.
  4. ^ Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP (Dec 1999). "The DNA sequence of human chromosome 22". Nature. 402 (6761): 489–95. Bibcode:1999Natur.402..489D. doi:10.1038/990031. PMID 10591208.
  5. ^ a b c "Entrez Gene: PRAME preferentially expressed antigen in melanoma".
  6. ^ Al-Khadairi G, Decock J (juli 2019). "Cancer Testis Antigens and Immunotherapy: Where Do We Stand in the Targeting of PRAME?". Cancers. 11 (7): 984. doi:10.3390/cancers11070984. PMC 6678383. PMID 31311081.
  7. ^ Epping MT, Wang L, Edel MJ, Carlée L, Hernandez M, Bernards R (septembar 2005). "The human tumor antigen PRAME is a dominant repressor of retinoic acid receptor signaling". Cell. 122 (6): 835–47. doi:10.1016/j.cell.2005.07.003. hdl:1874/17819. PMID 16179254. S2CID 18144920.
  8. ^ Al-Khadairi G, Naik A, Thomas R, Al-Sulaiti B, Rizly S, Decock J (januar 2019). "PRAME promotes epithelial-to-mesenchymal transition in triple negative breast cancer". Journal of Translational Medicine. 17 (1): 9. doi:10.1186/s12967-018-1757-3. PMC 6317205. PMID 30602372.
  9. ^ Gerdin AK (2010). "The Sanger Mouse Genetics Programme: high throughput characterisation of knockout mice". Acta Ophthalmologica. 88: 925–7. doi:10.1111/j.1755-3768.2010.4142.x. S2CID 85911512.
  10. ^ a b "International Mouse Phenotyping Consortium".
  11. ^ Skarnes WC, Rosen B, West AP, Koutsourakis M, Bushell W, Iyer V, Mujica AO, Thomas M, Harrow J, Cox T, Jackson D, Severin J, Biggs P, Fu J, Nefedov M, de Jong PJ, Stewart AF, Bradley A (Jun 2011). "A conditional knockout resource for the genome-wide study of mouse gene function". Nature. 474 (7351): 337–42. doi:10.1038/nature10163. PMC 3572410. PMID 21677750.
  12. ^ Dolgin E (Jun 2011). "Mouse library set to be knockout". Nature. 474 (7351): 262–3. doi:10.1038/474262a. PMID 21677718.
  13. ^ Collins FS, Rossant J, Wurst W (Jan 2007). "A mouse for all reasons". Cell. 128 (1): 9–13. doi:10.1016/j.cell.2006.12.018. PMID 17218247. S2CID 18872015.
  14. ^ White JK, Gerdin AK, Karp NA, Ryder E, Buljan M, Bussell JN, Salisbury J, Clare S, Ingham NJ, Podrini C, Houghton R, Estabel J, Bottomley JR, Melvin DG, Sunter D, Adams NC, Tannahill D, Logan DW, Macarthur DG, Flint J, Mahajan VB, Tsang SH, Smyth I, Watt FM, Skarnes WC, Dougan G, Adams DJ, Ramirez-Solis R, Bradley A, Steel KP (Jul 2013). "Genome-wide generation and systematic phenotyping of knockout mice reveals new roles for many genes". Cell. 154 (2): 452–64. doi:10.1016/j.cell.2013.06.022. PMC 3717207. PMID 23870131.
  15. ^ a b "Infection and Immunity Immunophenotyping (3i) Consortium". Arhivirano s originala, 21. 5. 2015. Pristupljeno 10. 2. 2022.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.