POP7

POP7
Identifikatori
AliasiPOP7
Vanjski ID-jeviOMIM: 606113 MGI: 1921347 HomoloGene: 4262 GeneCards: POP7
Lokacija gena (čovjek)
Hromosom 7 (čovjek)
Hrom.Hromosom 7 (čovjek)[1]
Hromosom 7 (čovjek)
Genomska lokacija za POP7
Genomska lokacija za POP7
Bend7q22.1Početak100,706,121 bp[1]
Kraj100,707,486 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za POP7
Genomska lokacija za POP7
Bend5|5 G2Početak137,499,700 bp[2]
Kraj137,500,780 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleic acid binding
GO:0001948, GO:0016582 vezivanje za proteine
hydrolase activity
vezivanje sa RNK
ribonuclease P activity
Ćelijska komponenta citoplazma
Jedarce
jedro
nucleolar ribonuclease P complex
nukleoplazma
ribonuclease MRP complex
multimeric ribonuclease P complex
Biološki proces tRNA processing
RNA phosphodiester bond hydrolysis, endonucleolytic
tRNA 5'-leader removal
RNA phosphodiester bond hydrolysis
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_005837

NM_028753

RefSeq (bjelančevina)

NP_005828

NP_083029

Lokacija (UCSC)Chr 7: 100.71 – 100.71 MbChr 5: 137.5 – 137.5 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Proteinska podjedinica p20 ribonukleaze P je enzim koji je kod ljudi kodiran genom POP7.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 140 aminokiselina, а molekulska težina Da. 15 651[7]

1020304050
MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLA
RCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAA
NTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000172336 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029715 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Jarrous N, Eder PS, Guerrier-Takada C, Hoog C, Altman S (Jun 1998). "Autoantigenic properties of some protein subunits of catalytically active complexes of human ribonuclease P". RNA. 4 (4): 407–17. PMC 1369627. PMID 9630247.
  6. ^ "Entrez Gene: POP7 processing of precursor 7, ribonuclease P subunit (S. cerevisiae)".
  7. ^ "UniProt, O75817" (jezik: engleski). Pristupljeno 28. 9. 2021.

Dopuska literatura

Vanjski linkovi

POP7 detalji ljudskog genoma u UCSC Genome Browser.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.