PERP

PERP
Identifikatori
AliasiPERP
Vanjski ID-jeviOMIM: 609301 MGI: 1929938 HomoloGene: 11098 GeneCards: PERP
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za PERP
Genomska lokacija za PERP
Bend6q23.3Početak138,088,505 bp[1]
Kraj138,107,419 bp[1]
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[2]
Hromosom 10 (miš)
Genomska lokacija za PERP
Genomska lokacija za PERP
Bend10|10 A3Početak18,720,768 bp[2]
Kraj18,732,821 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_022121

NM_022032

RefSeq (bjelančevina)

NP_071404

NP_071315

Lokacija (UCSC)Chr 6: 138.09 – 138.11 MbChr 10: 18.72 – 18.73 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

PMP-22 apoptozno srodni efektor p53 jest plazmamembranski protein koji je kod ljudi kodiran genom PERP.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 193 aminokiseline, а molekulska težina 21.386 Da.[7]

1020304050
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWK
CSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALC
GPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYN
WAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Funkcija

PERP je direktna transkripcijska meta p53, ali se njegova transkripcija može regulirati i drugim faktorima transkripcije.[8]

PERP je važan za razvoj kože, a gubitak PERP-a povezan je s razvojem i progresijom nekoliko tipova ljudskih kancera.[8]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000112378 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000019851 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Hildebrandt T, Preiherr J, Tarbe N, Klostermann S, Van Muijen GN, Weidle UH (Dec 2000). "Identification of THW, a putative new tumor suppressor gene". Anticancer Res. 20 (5A): 2801–2809. PMID 11062687.
  6. ^ "Entrez Gene: PERP PERP, TP53 apoptosis effector".
  7. ^ "UniProt, Q96FX8" (jezik: engleski). Pristupljeno 10. 10. 2021.
  8. ^ a b Roberts O, Paraoan L (Dec 2020). "PERP-ing into diverse mechanisms of cancer pathogenesis: Regulation and role of the p53/p63 effector PERP". Biochim Biophys Acta Rev Cancer. 1874 (1): 188393. doi:10.1016/j.bbcan.2020.188393. PMID 32679166. S2CID 220631324.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.