PCBD2

PCBD2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4C45

Identifikatori
AliasiPCBD2
Vanjski ID-jeviOMIM: 609836 MGI: 1919812 HomoloGene: 49987 GeneCards: PCBD2
EC broj4.2.1.96
Lokacija gena (čovjek)
Hromosom 5 (čovjek)
Hrom.Hromosom 5 (čovjek)[1]
Hromosom 5 (čovjek)
Genomska lokacija za PCBD2
Genomska lokacija za PCBD2
Bend5q31.1Početak134,905,120 bp[1]
Kraj135,007,959 bp[1]
Lokacija gena (miš)
Hromosom 13 (miš)
Hrom.Hromosom 13 (miš)[2]
Hromosom 13 (miš)
Genomska lokacija za PCBD2
Genomska lokacija za PCBD2
Bend13|13 B1Početak55,875,181 bp[2]
Kraj55,924,643 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
4-alpha-hydroxytetrahydrobiopterin dehydratase activity
phenylalanine 4-monooxygenase activity
lyase activity
Ćelijska komponenta jedro
ćelijska komponenta
Biološki proces tetrahydrobiopterin biosynthetic process
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
protein homotetramerization
protein heterooligomerization
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_032151

NM_028281

RefSeq (bjelančevina)

NP_115527

NP_082557

Lokacija (UCSC)Chr 5: 134.91 – 135.01 MbChr 13: 55.88 – 55.92 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Pterin-4-alfa-karbinolamin dehidrataza 2 jest enzim koji je kod ljudi kodiran genom PCBD2 sa hromosoma 5.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 130 aminokiselina, а molekulska težina 14.365 Da.[8]

1020304050
MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAA
GWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKV
QITLTSHDCGELTKKDVKLAKFIEKAAASV

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000132570 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000021496 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Rose RB, Pullen KE, Bayle JH, Crabtree GR, Alber T (Jun 2004). "Biochemical and structural basis for partially redundant enzymatic and transcriptional functions of DCoH and DCoH2". Biochemistry. 43 (23): 7345–55. doi:10.1021/bi049620t. PMID 15182178.
  6. ^ Lim S, Jin K, Friedman E (Jul 2002). "Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha". J Biol Chem. 277 (28): 25040–6. doi:10.1074/jbc.M203257200. PMID 11980910.
  7. ^ "Entrez Gene: PCBD2 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2".
  8. ^ "UniProt, Q9H0N5" (jezik: engleski). Pristupljeno 18. 10. 2021.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.