NPW

NPW
Identifikatori
AliasiNPW
Vanjski ID-jeviOMIM: 607997 MGI: 2685781 HomoloGene: 17727 GeneCards: NPW
Lokacija gena (čovjek)
Hromosom 16 (čovjek)
Hrom.Hromosom 16 (čovjek)[1]
Hromosom 16 (čovjek)
Genomska lokacija za NPW
Genomska lokacija za NPW
Bend16p13.3Početak2,009,926 bp[1]
Kraj2,020,755 bp[1]
Lokacija gena (miš)
Hromosom 17 (miš)
Hrom.Hromosom 17 (miš)[2]
Hromosom 17 (miš)
Genomska lokacija za NPW
Genomska lokacija za NPW
Bend17|17 A3.3Početak24,876,304 bp[2]
Kraj24,877,431 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
G protein-coupled receptor binding
Ćelijska komponenta extracellular region
Biološki proces neuropeptide signaling pathway
ponašanje pri hranjenju
G protein-coupled receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001099456

NM_001099664

RefSeq (bjelančevina)

NP_001092926

NP_001093134

Lokacija (UCSC)Chr 16: 2.01 – 2.02 MbChr 17: 24.88 – 24.88 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

NPW jegen koji ko ljudi kodoira protein zvani neuropeptid W.[5][6][7]

Neuropeptid W (NPW) je endogeni peptidni ligand za GPR8 (MIM 600731), receptor vezan za G-protein (prema OMIM[7])

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 165 aminokiselina, a molekulska težina 18.048 Da.[8]

Simboli
1020304050
MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAG
LLMGLRRSPYLWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWE
TRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDP
AANRLGLPCLAPGPF

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000183971 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000071230 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Fujii R, Yoshida H, Fukusumi S, Habata Y, Hosoya M, Kawamata Y, Yano T, Hinuma S, Kitada C, Asami T, Mori M, Fujisawa Y, Fujino M (Sep 2002). "Identification of a neuropeptide modified with bromine as an endogenous ligand for GPR7". J Biol Chem. 277 (37): 34010–6. doi:10.1074/jbc.M205883200. PMID 12118011.
  6. ^ Brezillon S, Lannoy V, Franssen JD, Le Poul E, Dupriez V, Lucchetti J, Detheux M, Parmentier M (Jan 2003). "Identification of natural ligands for the orphan G protein-coupled receptors GPR7 and GPR8". J Biol Chem. 278 (2): 776–83. doi:10.1074/jbc.M206396200. PMID 12401809.
  7. ^ a b "Entrez Gene: NPW neuropeptide W".
  8. ^ "UniProt, Q8N729". Pristupljeno 8. 7. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.