LSM6

LSM6
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3JCR

Identifikatori
AliasiLSM6
Vanjski ID-jeviOMIM: 607286 MGI: 1925901 HomoloGene: 38271 GeneCards: LSM6
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za LSM6
Genomska lokacija za LSM6
Bend4q31.22Početak146,175,703 bp[1]
Kraj146,200,000 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za LSM6
Genomska lokacija za LSM6
Bend8|8 C1Početak79,531,494 bp[2]
Kraj79,547,769 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
vezivanje sa RNK
Ćelijska komponenta citoplazma
citosol
nukleoplazma
small nuclear ribonucleoprotein complex
spliceosomal complex
Egzosom
jedro
P-tijelo
U6 snRNP
Jedarce
sno(s)RNA-containing ribonucleoprotein complex
U4/U6 x U5 tri-snRNP complex
U2-type precatalytic spliceosome
Lsm2-8 complex
Biološki proces tRNA processing
mRNA processing
Prerada RNK
exonucleolytic catabolism of deadenylated mRNA
rRNA processing
mRNA splicing, via spliceosome
maturation of SSU-rRNA
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_007080

NM_001191004
NM_030145

RefSeq (bjelančevina)

NP_009011

NP_001177933
NP_084421

Lokacija (UCSC)Chr 4: 146.18 – 146.2 MbChr 8: 79.53 – 79.55 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

U6 snRNK-pridruženi Sm-liki protein LSm6 jest protein koji je kod ljudi kodiran genom LSM6 sa hromosoma 4.[5][6][7]

Proteini slični Sm identificirani su u različitim organizmima na osnovu homologije sa proteinima porodice Sm (vidi SNRPD2; MIM 601061). Sm-slični proteini sadrže motiv Sm sekvence, koji se sastoji od dvije regije razdvojene linkerom varijabilne dužine koji se savija kao petlja.

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 80 aminokiselina, а molekulska težina 9.128 Da.[8]

1020304050
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE
YVNGQLKNKYGDAFIRGNNVLYISTQKRRM

Funkcija

Smatra se da proteini slični Sm formiraju stabilan heterodimer prisutan u česticama tri-snRNP, koje su važne za preradu pre-iRNK (prema OMIM).[7]

Dopunska literatura

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000164167 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000031683 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Salgado-Garrido J, Bragado-Nilsson E, Kandels-Lewis S, Seraphin B (Aug 1999). "Sm and Sm-like proteins assemble in two related complexes of deep evolutionary origin". EMBO J. 18 (12): 3451–62. doi:10.1093/emboj/18.12.3451. PMC 1171424. PMID 10369684.
  6. ^ Achsel T, Brahms H, Kastner B, Bachi A, Wilm M, Luhrmann R (Dec 1999). "A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro". EMBO J. 18 (20): 5789–802. doi:10.1093/emboj/18.20.5789. PMC 1171645. PMID 10523320.
  7. ^ a b "Entrez Gene: LSM6 LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)".
  8. ^ "UniProt, P62312" (jezik: engleski). Pristupljeno 30. 10. 2021.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.