LSM5

LSM5
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3JCR

Identifikatori
AliasiLSM5
Vanjski ID-jeviOMIM: 607285 MGI: 1913623 HomoloGene: 40833 GeneCards: LSM5
Lokacija gena (čovjek)
Hromosom 7 (čovjek)
Hrom.Hromosom 7 (čovjek)[1]
Hromosom 7 (čovjek)
Genomska lokacija za LSM5
Genomska lokacija za LSM5
Bend7p14.3Početak32,485,338 bp[1]
Kraj32,495,283 bp[1]
Lokacija gena (miš)
Hromosom 6 (miš)
Hrom.Hromosom 6 (miš)[2]
Hromosom 6 (miš)
Genomska lokacija za LSM5
Genomska lokacija za LSM5
Bend6|6 B3Početak56,678,048 bp[2]
Kraj56,681,695 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
vezivanje sa RNK
Ćelijska komponenta U6 snRNP
citosol
Lsm1-7-Pat1 complex
U4/U6 x U5 tri-snRNP complex
spliceosomal complex
jedro
nukleoplazma
U2-type precatalytic spliceosome
Lsm2-8 complex
Biološki proces nuclear-transcribed mRNA catabolic process
mRNA splicing, via spliceosome
mRNA processing
exonucleolytic catabolism of deadenylated mRNA
Prerada RNK
response to bacterium
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001130710
NM_001139499
NM_012322

NM_025520

RefSeq (bjelančevina)

NP_001124182
NP_001132971
NP_036454

NP_079796

Lokacija (UCSC)Chr 7: 32.49 – 32.5 MbChr 6: 56.68 – 56.68 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

U6 snRNK-pridruženi Sm-oliki protein LSm5 je protein koji je kod ljudi kodiran genom LSM5.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 91 aminokiselina, а molekulska težina 9.937 Da.[8]

1020304050
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMV
LEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Funkcija

Sm-liki proteini identifikovani su u različitim organizmima na osnovu komolgije sekvenci sa porodicom Sm proteina (vidi SNRPD2; MIM 601061). Sm-slični proteini sadrže Sm motiv sekvence, koji se sastoji od dvije regije odvojene poveznicom promjenjive dužine, koja se savija kao petlja. Smatra se da proteini slični Sm tvore stabilne heteromer u česticama tri-snRNP, koje su važne za preradu pre-iRNK (prema OMIMu)[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000106355 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000091625 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Salgado-Garrido J, Bragado-Nilsson E, Kandels-Lewis S, Seraphin B (Aug 1999). "Sm and Sm-like proteins assemble in two related complexes of deep evolutionary origin". EMBO J. 18 (12): 3451–62. doi:10.1093/emboj/18.12.3451. PMC 1171424. PMID 10369684.
  6. ^ Ingelfinger D, Arndt-Jovin DJ, Luhrmann R, Achsel T (Jan 2003). "The human LSm1-7 proteins colocalize with the mRNA-degrading enzymes Dcp1/2 and Xrnl in distinct cytoplasmic foci". RNA. 8 (12): 1489–501. doi:10.1017/S1355838202021726 (neaktivno 31. 5. 2021). PMC 1370355. PMID 12515382.CS1 održavanje: DOI nije aktivan od 2021 (link)
  7. ^ a b "Entrez Gene: LSM5 LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)".
  8. ^ "UniProt, Q9Y4Y9" (jezik: engleski). Pristupljeno 26. 9. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.