LSM1

LSM1
Identifikatori
AliasiLSM1
Vanjski ID-jeviOMIM: 607281 MGI: 1914457 HomoloGene: 40945 GeneCards: LSM1
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[1]
Hromosom 8 (miš)
Genomska lokacija za LSM1
Genomska lokacija za LSM1
Bend8|8 A2Početak26,275,316 bp[1]
Kraj26,294,003 bp[1]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
RNA cap binding
pre-mRNA binding
mRNA binding
vezivanje sa RNK
Ćelijska komponenta citosol
P-tijelo
messenger ribonucleoprotein complex
Akson
soma
dendrit
jedro
citoplazma
mRNA cap binding complex
Lsm1-7-Pat1 complex
Biološki proces negative regulation of neuron differentiation
deadenylation-dependent decapping of nuclear-transcribed mRNA
RNA splicing, via transesterification reactions
mRNA processing
stem cell population maintenance
Prerada RNK
exonucleolytic catabolism of deadenylated mRNA
histone mRNA catabolic process
nuclear-transcribed mRNA catabolic process
RNA metabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014462

NM_026032

RefSeq (bjelančevina)

NP_055277

NP_080308

Lokacija (UCSC)n/aChr 8: 26.28 – 26.29 Mb
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

U6 snRNK-pridruženi Sm-oliki protein LSm1 je protein koji je kod ljudi kodiran genom LSM1.[4][5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 133 aminokiseline, а molekulska težina 15.179 Da.[7]

1020304050
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERI
HVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQR
VEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

Funkcija

Smoliki proteini su identifikovani u različitim organizmima na osnovu homologije sekvenci sa porodicom Sm-proteina (vidi SNRPD2). Proteini slični Sm-u sadrže motiv Sm sekvence, koji se sastoji od dvije regije odvojene poveznicom promjenjive dužine koja se savija kao petlja. Smatra se da proteini slični Sm tvore stabilan heteromer prisutan u tri-snRNP česticama, koji su važni u prepreradi iRNK.[6]

Reference

  1. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000037296 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ Ingelfinger D, Arndt-Jovin DJ, Luhrmann R, Achsel T (Jan 2003). "The human LSm1-7 proteins colocalize with the mRNA-degrading enzymes Dcp1/2 and Xrnl in distinct cytoplasmic foci". RNA. 8 (12): 1489–501. doi:10.1017/S1355838202021726 (neaktivno 31. 5. 2021). PMC 1370355. PMID 12515382.CS1 održavanje: DOI nije aktivan od 2021 (link)
  5. ^ Takahashi S, Suzuki S, Inaguma S, Cho YM, Ikeda Y, Hayashi N, Inoue T, Sugimura Y, Nishiyama N, Fujita T, Ushijima T, Shirai T (Apr 2002). "Down-regulation of Lsm1 is involved in human prostate cancer progression". Br J Cancer. 86 (6): 940–6. doi:10.1038/sj.bjc.6600163. PMC 2364150. PMID 11953827.
  6. ^ a b "Entrez Gene: LSM1 LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)".
  7. ^ "UniProt, O15116" (jezik: engleski). Pristupljeno 19. 9. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.