LACTB2

LACTB2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4AD9

Identifikatori
AliasiLACTB2
Vanjski ID-jeviMGI: 2442551 HomoloGene: 9349 GeneCards: LACTB2
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za LACTB2
Genomska lokacija za LACTB2
Bend8q13.3Početak70,635,318 bp[1]
Kraj70,669,185 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za LACTB2
Genomska lokacija za LACTB2
Bend1|1 A3Početak13,693,554 bp[2]
Kraj13,730,770 bp[2]
Ontologija gena
Molekularna funkcija• vezivanje iona metala
• hydrolase activity
• GO:0001948, GO:0016582 vezivanje za proteine
• nuclease activity
• endoribonuclease activity
• vezivanje sa RNK
• vezivanje iona cinka
• single-stranded RNA binding
• endonuclease activity
Ćelijska komponenta• mitohondrija
• mitochondrial matrix
Biološki proces• RNA phosphodiester bond hydrolysis, endonucleolytic
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez

51110

212442

Ensembl

ENSG00000147592

ENSMUSG00000025937

UniProt

Q53H82

Q99KR3

RefSeq (mRNK)

NM_016027

NM_145381

RefSeq (bjelančevina)

NP_057111

NP_663356

Lokacija (UCSC)Chr 8: 70.64 – 70.67 MbChr 1: 13.69 – 13.73 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Laktamaza beta 2 je enzim koji je kod ljudi kodiran genom LACTB2.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 288 aminokiselina, а molekulska težina 32.806 Da.[6]

1020304050
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEP
AIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYC
IKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHM
ALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHG
PVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTP
ENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL

Struktura

LACTB2 se nalazi na hromosomu 8, a njegova specifična lokacija je 8q13.3; sadrži sedam egzona.[5]

Protein LACTB2 [1] ima nabor metalo β-laktamaze (MBL), s dva iona cinka na aktivnom mjestu.

Funkcija

Metalo beta-laktamaze su prvi put identificirane u bakterijama; nekim sojevima daju rezistenciju na antibiotike, razgradnjom beta-laktamskih antibiotika (poput penicilina). Međutim, porodica proteina uključuje mnoge članove koji su ribonukleaze (RNaze), dezoksiribonukleaze (Dnkaze) i drugi metabolički enzimi [7] MBL-ribonukleaze odgovorne su za obradu RNK, stvarajući 3' kraj tRNK, (RNaza Z[8]) molekula eukariotske iRNK (CPSF-73) i snRNK.[9] LACTB2 je mitohondrijska endoribonukleaza koja može imati ulogu u razgradnji mitohondrijske iRNK.[10]

Klinički značaj

Tumor-specifična fuzija LACTB2-NCOA2 koja potiče od unutarhromosomskog preslagivanja hromosoma 8 identificirana je na nivou DNK i RNK. Za razliku od konvencijskih onkogenih himernih proteina, fuzijskom proizvodu nedostaje funkcionalni domen iz odgovarajućih gena, što ukazuje na amorfnu reorganizaciju. Ovaj himerični transkript LACTB2-NCOA2 otkriven je u 6 od 99 (6,1%) slučajeva kolorektumskog karcinoma (CRC), gdje je NCOA2 bio značajno snižen. Prisilna ekspresija NCOA2 divljeg tipa, ali ne i fuzijskog proteina LACTB2-NCOA2, narušila je protivmorigenske fenotipove CRC ćelija, dok je nokdauiranje endogenog NCOA2 u normalnim kolonocitima imalo suprotne učinke. Mehanički, NCOA2 je inhibirao signalizaciju Wnt/β-katenina, putem istovremeno povećanih inhibitora i stimulatora snižavanja Wnt/β-kateninskog puta. NCOA2 je novi regulatorni gen s negativnim rastom koji potiskuje put Wnt/β-katenina u CRC-u, gdje ponavljana fuzija s LACTB2 doprinosi njegovom poremećaju.[11]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000147592 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000025937 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: Lactamase, beta 2". Pristupljeno 7. 7. 2015.
  6. ^ "UniProt, Q53H82" (jezik: engleski). Pristupljeno 19. 9. 2021.
  7. ^ Dominski Z (1. 3. 2007). "Nucleases of the metallo-beta-lactamase family and their role in DNA and RNA metabolism". Critical Reviews in Biochemistry and Molecular Biology. 42 (2): 67–93. doi:10.1080/10409230701279118. PMID 17453916. S2CID 26906168.
  8. ^ Vogel A, Schilling O, Späth B, Marchfelder A (decembar 2005). "The tRNase Z family of proteins: physiological functions, substrate specificity and structural properties". Biological Chemistry. 386 (12): 1253–64. doi:10.1515/BC.2005.142. PMID 16336119. S2CID 22522356.
  9. ^ Albrecht TR, Wagner EJ (mart 2012). "snRNA 3' end formation requires heterodimeric association of integrator subunits". Molecular and Cellular Biology. 32 (6): 1112–23. doi:10.1128/MCB.06511-11. PMC 3295014. PMID 22252320.
  10. ^ Levy S, Allerston CK, Liveanu V, Habib MR, Gileadi O, Schuster G (februar 2016). "Identification of LACTB2, a metallo-β-lactamase protein, as a human mitochondrial endoribonuclease". Nucleic Acids Research. 44 (4): 1813–32. doi:10.1093/nar/gkw050. PMC 4770246. PMID 26826708.
  11. ^ Yu J, Wu WK, Liang Q, Zhang N, He J, Li X, Zhang X, Xu L, Chan MT, Ng SS, Sung JJ (januar 2016). "Disruption of NCOA2 by recurrent fusion with LACTB2 in colorectal cancer". Oncogene. 35 (2): 187–95. doi:10.1038/onc.2015.72. PMC 4717154. PMID 25823027.

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.