HIST2H2AB

HIST2H2AB
Identifikatori
AliasiH2AC21
Vanjski ID-jeviOMIM: 615014 MGI: 2448314 HomoloGene: 111318 GeneCards: H2AC21
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za HIST2H2AB
Genomska lokacija za HIST2H2AB
Bend1q21.2Početak149,887,469 bp[1]
Kraj149,887,965 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za HIST2H2AB
Genomska lokacija za HIST2H2AB
Bend3|3 F2.1Početak96,127,181 bp[2]
Kraj96,127,624 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija vezivanje sa DNK
protein heterodimerization activity
molekularna funkcija
Ćelijska komponenta Nukleosom
Egzosom
jedro
hromosom
Biološki proces GO:0031497, GO:0006336, GO:0034724, GO:0001301, GO:0007580, GO:0034652, GO:0010847 chromatin organization
GO:0022610 biološki proces
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_175065

NM_178213

RefSeq (bjelančevina)

NP_778235

NP_835585

Lokacija (UCSC)Chr 1: 149.89 – 149.89 MbChr 3: 96.13 – 96.13 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Histon H2A tip 2-B jest protein koji je kod ljudi kodiran genom HIST2H2AB sa hromosoma 1.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 130 aminokiselina, a molekulska težina 13.995 Da.[7]

1020304050
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPV
YLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGG
VTIAQGGVLPNIQAVLLPKKTESHKPGKNK

Funkcija

Histoni su osnovni jedarni proteini koji su odgovorni za nukleosomsku strukturu hromosomskog vlakna u eukariotima. Nukleosomi se sastoje od približno 146 bp DNK omotane oko histonskog oktamera, sastavljenog od parova svakog od četiri jezgra histona (H2A, H2B, H3 i H4). Hromatinsko vlakno se dalje sabija kroz interakciju histonskog linkera H1, sa DNK između nukleosoma, kako bi se formirale strukture hromatina višeg reda. Ovaj gen je bez introna i kodira člana porodice histoni H2A. Transkripti ovog gena sadrže palindromski terminacijski element.[6]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000184270 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000063689 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Marzluff WF, Gongidi P, Woods KR, Jin J, Maltais LJ (Oct 2002). "The human and mouse replication-dependent histone genes". Genomics. 80 (5): 487–98. doi:10.1016/S0888-7543(02)96850-3. PMID 12408966.
  6. ^ a b "Entrez Gene: HIST2H2AB histone cluster 2, H2ab".
  7. ^ "UniProt, Q8IUE6" (jezik: en.). Pristupljeno 12. 12. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.