HCST

HCST
Identifikatori
AliasiHCST
Vanjski ID-jeviOMIM: 604089 MGI: 1344360 HomoloGene: 8024 GeneCards: HCST
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za HCST
Genomska lokacija za HCST
Bend19q13.12Početak35,902,529 bp[1]
Kraj35,904,377 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za HCST
Genomska lokacija za HCST
Bend7 B1|7 17.45 cMPočetak30,117,137 bp[2]
Kraj30,119,279 bp[2]
Ontologija gena
Molekularna funkcija signaling receptor binding
GO:0001948, GO:0016582 vezivanje za proteine
phosphatidylinositol 3-kinase binding
Ćelijska komponenta integral component of membrane
cell surface
ćelijska membrana
membrana
Biološki proces protein phosphorylation
regulation of immune response
positive regulation of phosphatidylinositol 3-kinase signaling
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014266
NM_001007469

NM_011827

RefSeq (bjelančevina)

NP_001007470
NP_055081

NP_035957

Lokacija (UCSC)Chr 19: 35.9 – 35.9 MbChr 7: 30.12 – 30.12 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Pretvarač signala hematopoetskih ćelija ili tranduktor signala hematopoetskih signala je protein koji je dod ljudi kodiran genom HCST.[5][6]

Ovaj gen kodira transmembranski signalni adapter koji sadrži YxxM motiv u svojoj citoplazmatskom domenu. Kodirani protein može činiti dio kompleksa receptora imunskog prepoznavanja sa receptorom sličnim lektinu C tipa NKG2D. Kao dio ovog receptorskog kompleksa, ovaj protein može aktivirati signalne puteve ovisne o fosfatidilinozitol 3-kinazi, preko svog intracitoplazmatskog motiva YxxM.

Ovaj receptorski kompleks može imati ulogu u preživljavanju i proliferaciji ćelija, aktivacijom odgovora NK i T-ćelija. Alternativna prerada rezultira u dvije varijante transkripta, koji kodiraju različite izoforme.[6]

Aminokiselinska sekvenca

Simboli
1020304050
MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLL
AGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000126264 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000064109 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Wu J, Song Y, Bakker AB, Bauer S, Spies T, Lanier LL, Phillips JH (Aug 1999). "An activating immunoreceptor complex formed by NKG2D and DAP10". Science. 285 (5428): 730–2. doi:10.1126/science.285.5428.730. PMID 10426994.
  6. ^ a b "Entrez Gene: HCST hematopoietic cell signal transducer".

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.