FRAT2

FRAT2
Identifikatori
AliasiFRAT2
Vanjski ID-jeviOMIM: 605006 MGI: 2673967 HomoloGene: 8095 GeneCards: FRAT2
Lokacija gena (čovjek)
Hromosom 10 (čovjek)
Hrom.Hromosom 10 (čovjek)[1]
Hromosom 10 (čovjek)
Genomska lokacija za FRAT2
Genomska lokacija za FRAT2
Bend10q24.1Početak97,332,497 bp[1]
Kraj97,334,729 bp[1]
Lokacija gena (miš)
Hromosom 19 (miš)
Hrom.Hromosom 19 (miš)[2]
Hromosom 19 (miš)
Genomska lokacija za FRAT2
Genomska lokacija za FRAT2
Bend19 C3|19 35.33 cMPočetak41,834,411 bp[2]
Kraj41,836,571 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija molekularna funkcija
Ćelijska komponenta citosol
ćelijska komponenta
citoplazma
Biološki proces multicellular organism development
Ćelijska proliferacija
Wnt-signalni put
beta-catenin destruction complex disassembly
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_012083

NM_177603

RefSeq (bjelančevina)

NP_036215

NP_808271

Lokacija (UCSC)Chr 10: 97.33 – 97.33 MbChr 19: 41.83 – 41.84 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

GSK-3-vezujući protein FRAT2 je protein koji je kod ljudi kodiran genom FRAT2.[5][6][7]

Protein kodiran ovim bezintronskim genom pripada porodici proteina koji se vezuju za GSK-3. Studije pokazuju da ovaj protein ima ulogu pozitivnog regulatora WNT-signalnog puta. Može se povećati u progresiji tumora.[7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 233 aminokiseline, а molekulska težina 24.051 Da.[8]

1020304050
MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGET
LQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPADKARPPAVPLLLPPASA
ETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLR
DAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAV
AAVAATGPASAPGPGGGRSGPDRIALQPSGSLL

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000181274 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000047604 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Yost C, Farr GH 3rd, Pierce SB, Ferkey DM, Chen MM, Kimelman D (Jul 1998). "GBP, an inhibitor of GSK-3, is implicated in Xenopus development and oncogenesis". Cell. 93 (6): 1031–41. doi:10.1016/S0092-8674(00)81208-8. PMID 9635432. S2CID 17951152.
  6. ^ Saitoh T, Moriwaki J, Koike J, Takagi A, Miwa T, Shiokawa K, Katoh M (Mar 2001). "Molecular cloning and characterization of FRAT2, encoding a positive regulator of the WNT signaling pathway". Biochem Biophys Res Commun. 281 (3): 815–20. doi:10.1006/bbrc.2001.4421. PMID 11237732.
  7. ^ a b "Entrez Gene: FRAT2 frequently rearranged in advanced T-cell lymphomas 2".
  8. ^ "UniProt, O75474". Pristupljeno 2. 9. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.