FBXO2

Fbxo2
Dostupne strukture
PDBPretraga Human UniProta: PDBe RCSB
Spisak PDB ID kodova

1UMH, 1UMI, 2E31, 2E32, 2E33, 2RJ2

Identifikatori
Aliasi
Vanjski ID-jeviHomoloGene: 8132 GeneCards: [1]
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)
Hromosom 4 (čovjek)
Genomska lokacija za Fbxo2
Genomska lokacija za Fbxo2
Bend4 E2|4 78.68 cMPočetak148,245,078 bp
Kraj148,250,881 bp
Ontologija gena
Molekularna funkcija amyloid-beta binding
carbohydrate binding
GO:0050372 aktivnost sa transferazom ubikvitina
GO:0001948, GO:0016582 vezivanje za proteine
GO:1904264, GO:1904822, GO:0090622, GO:0090302 ubiquitin protein ligase activity
Ćelijska komponenta SCF ubiquitin ligase complex
organelle membrane
citosol
dendritična kičma
Endoplazmatski retikulum
membrana
intracellular membrane-bounded organelle
citoplazma
Biološki proces ubiquitin-dependent ERAD pathway
SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
regulation of protein ubiquitination
protein ubiquitination
ubiquitin-dependent protein catabolic process
glycoprotein catabolic process
negative regulation of cell population proliferation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_176848

n/a

RefSeq (bjelančevina)

NP_789818

NP_789818

Lokacija (UCSC)Chr 4: 148.25 – 148.25 Mbn/a
PubMed pretraga[1]n/a
Wikipodaci
Pogledaj/uredi – čovjek

Jedini F-kutijski protein 2 jest protein koji je kod ljudi kodiran genom FBXO2 sa hromosoma 1.[2][3][4]

Amiokiselininska sekvenca

Dužina polipeptidnog lanca je 296 aminokiselina, a molekulska težina 33.328 Da.[5]

1020304050
MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDEL
PEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPE
GGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEE
LPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPA
IVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGW
MEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP

Funkcija

Ovaj gen kodira člana porodice F-kutijskih proteina koji se odlikuje motivom od približno 40 aminokiselina, F-kutijom. Proteini F-kutije čine jednu od četiri podjedinice ubikvitinske proteinskog ligaznog kompleksa zvanog SCFs (SKP1-kulin-F-kutija), koji funkcioniše u fosforilaciono-zavisnoj ubikvitinaciji .

Proteini F-kutije podijeljeni su u tri klase: Fbws koji sadrže WD-40 domen, Fbls koji sadrže leucin bogata ponavljanja i Fbxs koji sadrže ili različite module interakcije protein-protein ili ne sadrže prepoznatljive motive. Protein kodiran ovim genom pripada klasi Fbxs. Ovaj protein je veoma sličan pacovskom proteinu NFB42 (neuralni F-kutijski sa 42 kDa) koji je obogaćen u nervnom sistemu i može imati ulogu u održavanju neurona u postmitotskom stanju.[4]

Reference

  1. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  2. ^ Cenciarelli C, Chiaur DS, Guardavaccaro D, Parks W, Vidal M, Pagano M (Dec 1999). "Identification of a family of human F-box proteins". Curr Biol. 9 (20): 1177–9. doi:10.1016/S0960-9822(00)80020-2. PMID 10531035. S2CID 7467493.
  3. ^ Winston JT, Koepp DM, Zhu C, Elledge SJ, Harper JW (Dec 1999). "A family of mammalian F-box proteins". Curr Biol. 9 (20): 1180–2. doi:10.1016/S0960-9822(00)80021-4. PMID 10531037. S2CID 14341845.
  4. ^ a b "Entrez Gene: FBXO2 F-box protein 2".
  5. ^ "UniProt, Q9UK22" (jezik: eng.). Pristupljeno 26. 11. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.